KEGG   Arabidopsis thaliana (thale cress): AT3G45610Help
Entry
AT3G45610         CDS       T00041                                 

Definition
(RefSeq) Dof zinc finger protein DOF3.2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 245 aa AA seqDB search
MDYSSMHQNVMGVSSCSTQDYQNQKKPLSATRPAPPEQSLRCPRCDSTNTKFCYYNNYSL
SQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKRSSSATKSLRTTPEPTMTHDGKSFPTA
SFGYNNNNISNEQMELGLAYALLNKQPLGVSSHLGFGSSQSPMAMDGVYGTTSHQMENTG
YAFGNGGGGMEQMATSDPNRVLWGFPWQMNMGGGSGHGHGHVDQIDSGREIWSSTVNYIN
TGALL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggattattcttcgatgcatcagaatgtgatgggagtatcttcatgttcaacacaagat
tatcaaaaccagaagaaaccattgtcggcgactaggccagctccaccagagcaatcatta
agatgccctcgctgtgactccaccaacacaaagttctgctactacaacaactacagtctc
tctcaacctcgctacttctgcaaatcttgtaggagatactggaccaagggtggaatccta
agaaacatcccaatcggtggtgcttaccggaaacacaaacgctcctcctccgcaaccaaa
agcctcagaacaacccctgagcccacgatgacccatgacggcaaatcattcccaacggcg
agttttggctataataataataacattagcaacgaacagatggagcttgggttagcatat
gccttgttgaacaagcaacctctaggggtttcttcacatctagggttcggaagctctcag
tctccaatggccatggatggcgtgtatgggaccacgagccatcagatggagaacacgggg
tatgcgtttggaaatggtggaggcggtatggagcagatggcgacaagtgatccaaacagg
gttttgtggggattcccctggcagatgaacatgggaggaggaagtggtcatggtcatggt
catgttgatcagattgattcagggagagagatttggagcagtactgtcaactacattaat
actggtgctttattgtag

DBGET integrated database retrieval system