KEGG   Arabidopsis thaliana (thale cress): AT3G45610Help
Entry
AT3G45610         CDS       T00041                                 

Gene name
DOF6
Definition
(RefSeq) Dof-type zinc finger DNA-binding family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Dof PHD OrfB_Zn_ribbon zf-SNAP50_C
Motif
Other DBs
NCBI-GeneID: 823703
NCBI-ProteinID: NP_190147
MIPS: AT3G45610.1
TAIR: AT3G45610
Araport: AT3G45610
UniProt: Q9M1E6
Position
3
AA seq 245 aa AA seqDB search
MDYSSMHQNVMGVSSCSTQDYQNQKKPLSATRPAPPEQSLRCPRCDSTNTKFCYYNNYSL
SQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKRSSSATKSLRTTPEPTMTHDGKSFPTA
SFGYNNNNISNEQMELGLAYALLNKQPLGVSSHLGFGSSQSPMAMDGVYGTTSHQMENTG
YAFGNGGGGMEQMATSDPNRVLWGFPWQMNMGGGSGHGHGHVDQIDSGREIWSSTVNYIN
TGALL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggattattcttcgatgcatcagaatgtgatgggagtatcttcatgttcaacacaagat
tatcaaaaccagaagaaaccattgtcggcgactaggccagctccaccagagcaatcatta
agatgccctcgctgtgactccaccaacacaaagttctgctactacaacaactacagtctc
tctcaacctcgctacttctgcaaatcttgtaggagatactggaccaagggtggaatccta
agaaacatcccaatcggtggtgcttaccggaaacacaaacgctcctcctccgcaaccaaa
agcctcagaacaacccctgagcccacgatgacccatgacggcaaatcattcccaacggcg
agttttggctataataataataacattagcaacgaacagatggagcttgggttagcatat
gccttgttgaacaagcaacctctaggggtttcttcacatctagggttcggaagctctcag
tctccaatggccatggatggcgtgtatgggaccacgagccatcagatggagaacacgggg
tatgcgtttggaaatggtggaggcggtatggagcagatggcgacaagtgatccaaacagg
gttttgtggggattcccctggcagatgaacatgggaggaggaagtggtcatggtcatggt
catgttgatcagattgattcagggagagagatttggagcagtactgtcaactacattaat
actggtgctttattgtag

DBGET integrated database retrieval system