KEGG   Arabidopsis thaliana (thale cress): AT3G45640Help
Entry
AT3G45640         CDS       T00041                                 

Gene name
MPK3
Definition
mitogen-activated protein kinase 3
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT3G45640 (MPK3)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT3G45640 (MPK3)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AT3G45640 (MPK3)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G45640 (MPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 370 aa AA seqDB search
MNTGGGQYTDFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTET
NELVAMKKIANAFDNHMDAKRTLREIKLLRHLDHENIIAIRDVVPPPLRRQFSDVYISTE
LMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKI
CDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFP
GKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAIDL
VDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMIYQ
EAIALNPTYG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccggcggtggccaatacacggattttccggcggtggaaactcacggaggacag
ttcataagttacgatatcttcggtagtttattcgagatcacatctaagtatcgtcctccg
attataccaattggtcgtggagcttatggaatcgtttgctctgtgttggatacggagacg
aacgagctagtagcgatgaagaagatagctaatgcttttgataatcatatggatgctaag
cgtacgcttcgtgagatcaagcttcttcgtcatcttgatcatgaaaacattatagctata
agagatgttgttccaccaccactaagaagacagttcagtgatgtttatatctctactgaa
ttaatggatactgatcttcatcaaatcatcagatctaaccagagtttatcagaagaacac
tgtcagtacttcttgtaccagctacttcgaggactgaagtatatccactcagctaacatt
attcatagggatttaaagccgagcaatcttctgttgaacgcgaattgcgatttaaagatt
tgtgatttcggtcttgctagacctacttcagagaatgattttatgactgagtatgttgtt
acgagatggtatagagcacctgagcttctgttgaactcttcagattacacagctgctatt
gatgtttggtctgttggttgtatctttatggagcttatgaatagaaagcctttgttccct
ggtaaagaccatgttcatcaaatgcgcttattgacagagttgcttggcacaccgacagaa
tctgatctcggttttactcacaatgaggatgcgaaaagatacatccggcaacttcccaac
ttcccacgtcagcccttagctaaacttttctctcatgttaacccaatggccattgatctt
gttgacagaatgttgacgtttgaccccaacagaagaatcactgttgaacaagctctgaat
caccagtaccttgctaaattgcacgacccgaatgatgagccaatctgtcaaaagccattc
tcttttgagttcgaacaacagcctctggatgaggaacagataaaagagatgatctaccaa
gaagccatagcactcaatccaacatacggttag

DBGET integrated database retrieval system