KEGG   Arabidopsis thaliana (thale cress): AT3G45780Help
Entry
AT3G45780         CDS       T00041                                 

Gene name
PHOT1
Definition
(RefSeq) phototropin 1
  KO
K08282  
non-specific serine/threonine protein kinase [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G45780 (PHOT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 996 aa AA seqDB search
MEPTEKPSTKPSSRTLPRDTRGSLEVFNPSTQLTRPDNPVFRPEPPAWQNLSDPRGTSPQ
PRPQQEPAPSNPVRSDQEIAVTTSWMALKDPSPETISKKTITAEKPQKSAVAAEQRAAEW
GLVLKTDTKTGKPQGVGVRNSGGTENDPNGKKTTSQRNSQNSCRSSGEMSDGDVPGGRSG
IPRVSEDLKDALSTFQQTFVVSDATKPDYPIMYASAGFFNMTGYTSKEVVGRNCRFLQGS
GTDADELAKIRETLAAGNNYCGRILNYKKDGTSFWNLLTIAPIKDESGKVLKFIGMQVEV
SKHTEGAKEKALRPNGLPESLIRYDARQKDMATNSVTELVEAVKRPRALSESTNLHPFMT
KSESDELPKKPARRMSENVVPSGRRNSGGGRRNSMQRINEIPEKKSRKSSLSFMGIKKKS
ESLDESIDDGFIEYGEEDDEISDRDERPESVDDKVRQKEMRKGIDLATTLERIEKNFVIT
DPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDLTTVKKIRNAIDNQTEVTV
QLINYTKSGKKFWNIFHLQPMRDQKGEVQYFIGVQLDGSKHVEPVRNVIEETAVKEGEDL
VKKTAVNIDEAVRELPDANMTPEDLWANHSKVVHCKPHRKDSPPWIAIQKVLESGEPIGL
KHFKPVKPLGSGDTGSVHLVELVGTDQLFAMKAMDKAVMLNRNKVHRARAEREILDLLDH
PFLPALYASFQTKTHICLITDYYPGGELFMLLDRQPRKVLKEDAVRFYAAQVVVALEYLH
CQGIIYRDLKPENVLIQGNGDISLSDFDLSCLTSCKPQLLIPSIDEKKKKKQQKSQQTPI
FMAEPMRASNSFVGTEEYIAPEIISGAGHTSAVDWWALGILMYEMLYGYTPFRGKTRQKT
FTNVLQKDLKFPASIPASLQVKQLIFRLLQRDPKKRLGCFEGANEVKQHSFFKGINWALI
RCTNPPELETPIFSGEAENGEKVVDPELEDLQTNVF
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaacagaaaaaccatcgaccaaaccatcttctcggactctacctagagacact
cgtggctctctcgaagtattcaacccgtcaactcagctgacccgacccgataacccggtg
ttccgtcctgaaccaccagcgtggcaaaacttgagtgatccacgtggcaccagtcctcaa
ccccgaccacaacaagaaccagctccatccaaccctgttcggtctgatcaagaaatcgct
gtcacgacctcatggatggctctgaaagacccatcaccggagacaatctccaagaagacg
atcaccgccgagaaaccacagaagtcggcggtggcggctgagcagagagcggcagagtgg
ggattggttttgaagaccgatacaaagacgggaaagccacaaggagtaggcgtgaggaac
tctggtggaactgagaatgatcctaacgggaaaaagactacatcgcagagaaactcgcaa
aactcttgccggagctccggtgagatgtcggacggagatgttcccggcgggaggagtggg
attccaagagtatcggaagatctaaaagatgcgttgtcgacgtttcaacaaacgtttgtg
gtctcagatgctacaaaacctgattatccgattatgtatgcaagtgctggtttcttcaat
atgactggttacacttccaaagaagtcgtcggcagaaactgccgatttttacaaggatca
ggtacagatgcagatgagttagcaaagataagagagacattagctgctggtaacaattat
tgtgggcgtatattgaattacaagaaagatgggacctctttttggaatcttctcacgatt
gctcccattaaagacgagagtggcaaagtcctcaaatttatcggaatgcaagtggaggtg
agcaagcacactgaaggggccaaagaaaaggctttgaggcccaatgggcttccggaatct
ctgattcgatacgatgcccgccaaaaagatatggcgacaaactcagtgacagagctagta
gaggcggtgaagagacctcgggcactaagcgaatcgacgaatctccatcccttcatgaca
aaatcggagagcgatgaacttccgaaaaaaccagctcggcgaatgtccgaaaatgttgtt
ccgtcaggccgaagaaactctggcggcggaagaagaaactcgatgcagcgaatcaacgaa
attcccgagaaaaaatctagaaaatcttccctttccttcatggggatcaagaagaagagc
gaatctttggatgaatctatagacgatggatttatagagtatggagaagaagacgatgag
attagtgatagggacgagagacctgagagtgtggatgataaagtgagacaaaaggaaatg
agaaagggtattgatctagctactacactcgaacgtatcgagaagaatttcgtcatcact
gatcctaggcttcccgataatcccattatttttgcatctgatagtttcttggagctcacg
gaatatagccgtgaagaaattcttggaagaaattgcaggtttctacaaggtccagagact
gatctaaccacagtgaagaagattcgaaatgctattgataaccaaaccgaagtgacagtt
cagctcatcaactacaccaagagcggaaagaagttctggaacattttccacttgcaacct
atgcgtgatcagaagggagaagtacaatactttattggagttcaactagacgggagcaag
cacgtagaaccagttcgcaatgtcattgaagaaaccgcagtgaaagagggagaagacctg
gtgaaaaaaacagctgtgaatatcgatgaagcggttcgagaacttcctgatgccaacatg
acaccagaggatttatgggcaaaccactcaaaggttgttcattgtaagcctcacaggaaa
gattcaccaccatggatagctatccaaaaggtgttggaaagtggtgaaccgattggtttg
aagcatttcaaaccggtgaaacctttgggttctggtgacacaggaagtgtgcatctagtg
gaactcgttggaacagatcagttgtttgcaatgaaagcaatggacaaggctgttatgctt
aaccgaaacaaagtacatagagctagagctgagagagagatcctagatttgcttgaccat
ccttttcttcctgcactctacgcttcttttcagacaaaaacacatatatgtcttataaca
gattactatccaggaggagaactcttcatgctcctagatcgacaacctaggaaggttctc
aaagaagatgctgtaagattctatgctgctcaagttgtcgttgcactcgagtatcttcac
tgtcaaggaataatttaccgagacttgaaaccggaaaacgttttaatccaaggcaatggc
gatatctctttgtcggattttgatctgtcttgcttgacatcttgcaaacctcagctgttg
attccgagtatagacgagaagaagaagaaaaagcaacaaaagagtcaacaaactccaatc
ttcatggctgaaccaatgcgtgcatcaaactcatttgttggcactgaagagtacattgct
ccggaaattatatccggagcaggacatacgagtgcagtagactggtgggctcttggtata
cttatgtatgaaatgttatacggatacactccttttagaggaaaaacaagacagaagact
ttcaccaatgttcttcaaaaagatctcaagtttccagctagcattcctgcaagtcttcaa
gtgaaacagctgatttttaggctgttacaacgagatccgaagaaaagactaggttgtttt
gaaggagcaaatgaagtcaagcaacattctttcttcaaaggcataaattgggctctgatt
cgatgcacgaaccctccagagctcgagactccgatattttctggtgaagctgaaaacgga
gagaaagttgttgatcctgagctagaagatctgcaaacaaatgttttttga

DBGET integrated database retrieval system