KEGG   Arabidopsis thaliana (thale cress): AT3G45980Help
Entry
AT3G45980         CDS       T00041                                 

Gene name
HTB9
Definition
histone HTB9
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 150 aa AA seqDB search
MAPRAEKKPAEKKPAAEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSV
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREI
QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagagcagagaagaagcccgcggagaagaaaccagccgccgagaaaccagta
gaggagaaatcaaaagccgagaaagctccggcggagaagaaaccaaaagccggcaagaaa
ctcccgaaggaagccggggccggcggcgataagaagaagaagatgaagaagaagagtgtg
gaaacttacaagatctacatcttcaaggttctgaaacaagttcatccagatattggtatt
tcaagcaaggctatgggtattatgaacagtttcatcaacgacatcttcgagaaattggca
tcggaatcttcaaagctcgctaggtataacaagaagccgacgattacttctcgggagatt
cagactgctgttagactcgttcttcctggtgagctcgctaaacacgctgtttctgaagga
accaaggctgttaccaaattcacaagctcttga

DBGET integrated database retrieval system