KEGG   Arabidopsis thaliana (thale cress): AT3G45980Help
Entry
AT3G45980         CDS       T00041                                 

Gene name
HTB9
Definition
(RefSeq) Histone superfamily protein
  KO
K11252  histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AT3G45980 (HTB9)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G45980 (HTB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 823741
NCBI-ProteinID: NP_190184
MIPS: AT3G45980.1
TAIR: AT3G45980
Araport: AT3G45980
UniProt: O23629 Q0WT91 A0A178V9F6
Position
3
AA seq 150 aa AA seqDB search
MAPRAEKKPAEKKPAAEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSV
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREI
QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagagcagagaagaagcccgcggagaagaaaccagccgccgagaaaccagta
gaggagaaatcaaaagccgagaaagctccggcggagaagaaaccaaaagccggcaagaaa
ctcccgaaggaagccggggccggcggcgataagaagaagaagatgaagaagaagagtgtg
gaaacttacaagatctacatcttcaaggttctgaaacaagttcatccagatattggtatt
tcaagcaaggctatgggtattatgaacagtttcatcaacgacatcttcgagaaattggca
tcggaatcttcaaagctcgctaggtataacaagaagccgacgattacttctcgggagatt
cagactgctgttagactcgttcttcctggtgagctcgctaaacacgctgtttctgaagga
accaaggctgttaccaaattcacaagctcttga

DBGET integrated database retrieval system