KEGG   Arabidopsis thaliana (thale cress): AT3G46030Help
Entry
AT3G46030         CDS       T00041                                 

Gene name
HTB11
Definition
histone HTB11
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G46030 (HTB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 145 aa AA seqDB search
MAPKAEKKPAEKKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKI
YIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVR
LVLPGELAKHAVSEGTKAVTKFTSS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggcagagaagaagccggcagagaagaaaccagtagaggagaaatcaaaa
gccgagaaagctcctgcagagaagaaaccaaaagccggcaagaaactcccgaaggaagcc
ggtgccggcggcgataagaagaagaagatgaagaagaagagtgttgagacgtacaagatc
tacatcttcaaggttctgaaacaagttcatccagatattggtatttcaagcaaagctatg
gggattatgaacagtttcatcaacgacatctttgagaaattggcatcggaatcgtcgaag
ctcgcgaggtataataagaagccgacgattacttctcgggagattcagactgctgttaga
cttgttcttcctggtgagcttgcgaaacatgctgtttctgaaggaactaaggcggtgact
aagtttactagctcttga

DBGET integrated database retrieval system