KEGG   Arabidopsis thaliana (thale cress): AT3G47340Help
Entry
AT3G47340         CDS       T00041                                 

Gene name
ASN1
Definition
asparagine synthetase [glutamine-hydrolyzing]
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ath00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 584 aa AA seqDB search
MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD
QPLFNEDKTIVVTVNGEIYNHEELRKRLKNHKFRTGSDCEVIAHLYEEYGVDFVDMLDGI
FSFVLLDTRDNSFMVARDAIGVTSLYIGWGLDGSVWISSEMKGLNDDCEHFETFPPGHFY
SSKLGGFKQWYNPPWFNESVPSTPYEPLAIRRAFENAVIKRLMTDVPFGVLLSGGLDSSL
VASITARHLAGTKAAKQWGPQLHSFCVGLEGSPDLKAGKEVAEYLGTVHHEFHFSVQDGI
DAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGADEIFGGYLYFHKAPN
KKEFHQETCRKIKALHKYDCLRANKSTSAFGLEARVPFLDKDFINTAMSLDPESKMIKPE
EGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVGYSWIDGLKDHAAQNVNDKMMSN
AGHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGGATVACSTAKAVEWDASWSNNMD
PSGRAAIGVHLSAYDGKNVALTIPPLKAIDNMPMMMGQGVVIQS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatacttgccgtgttaggatgttccgatgattctcaggccaagagagttcgt
gttcttgagctttctcgcagattgaggcacagaggacctgactggagtggcttatatcag
aacggagataattacttggcccatcaacgtcttgccgtcatcgatcctgcttccggtgat
caacctcttttcaacgaggacaagaccattgttgtcacggtgaacggagagatttataac
catgaggagctgagaaaacgtctgaagaatcacaagttccgtactggtagtgattgtgaa
gtcattgctcacttgtacgaggagtatggtgtggattttgttgatatgttggatggaata
ttctcctttgtgttgctcgacacacgagataactctttcatggtggctcgtgatgcgatt
ggtgtcacttcgctctacattggttggggactagacggatctgtgtggatatcttcagag
atgaaaggcctaaacgatgactgtgagcatttcgaaacgtttcctccaggtcatttttat
tcaagcaaattaggagggtttaagcaatggtataatcctccttggttcaatgaatctgtt
ccttcaacgccttatgagcctcttgcgataagacgcgcctttgaaaacgctgtgattaag
cggttgatgactgatgttccatttggagttttgctctctggtggtcttgattcttccctt
gttgcctccatcactgcacgtcacttggccggtactaaggcggctaagcaatggggtcct
cagctccattccttttgcgttggtcttgagggctcaccggacttgaaggcagggaaagag
gtggcggaatatttggggacggtgcaccacgagttccacttctcggtgcaggacgggatt
gatgcgatagaggatgtgatttaccatgttgagacctatgatgtgacgactatcagagcg
agcacaccgatgttcttgatgtcccggaaaatcaagtctctaggggtcaagatggttctc
tccggcgaaggtgcggacgagatctttggagggtacctctatttccacaaggcacctaac
aagaaagagtttcaccaagaaacttgtcgcaagatcaaggctcttcacaagtatgactgt
ctaagagccaacaaatctacctctgcctttggactagaggcacgtgttcctttccttgac
aaagacttcatcaacacagctatgtctctcgaccctgaatccaagatgatcaagccagag
gaaggaaggatcgagaaatgggttctaaggagagcctttgacgacgaagaacgtccttat
ctaccaaaacacattctctacagacagaaagaacagttcagtgatggtgttggctacagt
tggatcgatggcctgaaagatcacgctgctcaaaatgtcaatgacaagatgatgtcgaac
gcggggcatatcttccctcacaacactccaaacactaaagaagcttactactacagaatg
atctttgaaaggttcttcccgcagaactctgcgagactaacggttcctggaggtgccacc
gtggcttgttcgactgcaaaggcagtggagtgggatgcaagctggtccaacaatatggat
ccatcaggaagagccgctatcggagttcacctttcggcctacgatggcaagaacgtggca
ttgaccataccaccacttaaggcaattgacaacatgccgatgatgatgggtcaaggagtt
gtgattcagtcataa

DBGET integrated database retrieval system