KEGG   Arabidopsis thaliana (thale cress): AT3G47800Help
Entry
AT3G47800         CDS       T00041                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G47800
   00052 Galactose metabolism
    AT3G47800
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AT3G47800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 358 aa AA seqDB search
MVKKQSPLHVVGVSVLMVLLCSVNYSLCEKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDR
HGKQDDVVLGFDTVDGYKNDTTYFGAIVGRVANRIGGAKFKLNGHLYKTDPNEGRNTLHG
GSKGFSDVIWSVQKYVPTSHITFTYDSFDGEEGFPGNVTVKVTYMLIGENKLGVKMEAKP
LNKPTPINLALHTYWNLHSHNSGNILSHKIQLLAGKITPVDDKLIPTGEITSITGTPYDF
LEPREIGSRIHELPGGYDINYVIDGPIGKHLRKTAVVTEQVTGRKMELWTNQPGVQFYTS
NMMKRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYLHVMLFRFTAH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagcaatcgccattacacgttgtcggtgtgtctgttttgatggtgttgtta
tgcagtgttaattacagtctctgtgaaaagatcaaaacgtataagctcacaagaggaagc
ttaagtgttactttcactaactatggtgctgtcatgacctctcttctcctccctgacaga
catggaaaacaagacgatgttgttcttggatttgatactgttgatggttacaagaatgat
acaacatattttggagcaattgtgggaagagtggctaatagaataggaggtgctaaattc
aagttaaatggtcatctctacaaaaccgatcccaacgaaggccgtaacactctccatggt
ggttcaaagggatttagtgatgtgatttggtcagtccaaaagtatgttcccactagtcac
attactttcacatacgatagcttcgacggtgaagaaggttttccgggcaatgtgacggtg
aaagtgacgtacatgttgatcggagaaaacaaactcggtgtaaaaatggaagcaaagcca
ctcaacaaacctacaccaatcaacttagctctccacacttactggaacctccacagccac
aactccgggaacatcctctcccacaaaattcaactcctcgccggaaaaatcactcccgtc
gacgacaaactcattcccaccggagaaatcacctccattaccggaactccttacgatttc
ctcgagccacgtgagatcggtagccggatccacgaattacccggcggttacgacatcaat
tacgtgatcgacggaccgatcgggaaacatctgaggaaaactgcggttgtgacggagcaa
gtcaccgggaggaagatggagctgtggacgaatcagcctggtgttcagttttacacgagt
aatatgatgaaacgtgtcgtcggtaaaggtaaagccgtttatgagaaatacggtggcttg
tgtttggagactcaaggcttcccagattccgtcaatcacaagaactttccgtcgcagatt
gttaatcccggcgagagttatttgcatgttatgctcttcagattcactgctcactaa

DBGET integrated database retrieval system