KEGG   Arabidopsis thaliana (thale cress): AT3G49290Help
Entry
AT3G49290         CDS       T00041                                 

Gene name
ABIL2
Definition
(RefSeq) ABL interactor-like protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 824090
NCBI-ProteinID: NP_001030832
MIPS: AT3G49290.1
TAIR: AT3G49290
Araport: AT3G49290
UniProt: Q9M3A3 Q147L2
Position
3
AA seq 312 aa AA seqDB search
MPASHEASNYDEVSMQQSMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLK
DYAVKALVNTVDHLGSVTYKVNDFIDEKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQ
QSLVIDTPKFHKRYILPAGEIMTATNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPP
PVRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRSGSVATRKSASIS
RPTTPSKSRSITPIRYPSEPRRSASVRVAFEKDNQKETEQQQPSKSKRLLKALLSRRKTK
KDDTLYTFLDEY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtcacatgaagcttcaaattacgatgaggtttctatgcagcaaagtatgctc
ttctctgatggtcttcaggacttgaagaatctgcgagcgcagttgtattcagcagccgag
tatttcgaactatcttacacaaccgatgataaaaagcagattgttgtagagacactgaaa
gactacgctgtgaaggctctggtgaatacagttgaccatttaggctctgttacatataaa
gtgaatgactttatcgatgaaaaagtcgatgaagtatcagagaccgagctgcgagtatct
tgcatcgaacagaggctaagaatgtgccaagagtatatggatcatgaagggcgttcacag
caatcacttgttattgacactccaaagttccataaacgatacatcttacccgcgggtgaa
attatgactgctacaaatcttgaaaagcttaagtactttggaagcagtttagaggatgca
gatgattggaaccaattccgaaatgctgttcgtgctacaatccgggaaacgcctccacca
cctgttagaaaatcaacatctcagagttcatctccacggcaaccacctcaacgatcagca
accttttcgtttacctctaccattccaaagaaagaacaagataagagatcagtttcaccg
catcggtttccactactaagatctggatcagtcgctaccaggaagtcagcatcaatcagc
cgaccaacgacaccaagcaagagcagatctataactcctatacggtatccatcagaacca
agaagatcggcttcggtccgagtcgcattcgagaaagataaccagaaagaaacagagcag
caacaaccgagcaagagcaaacgattgctcaaggctttgcttagtcgacgcaaaaccaag
aaagatgacactctctacactttcttggacgaatactga

DBGET integrated database retrieval system