KEGG   Arabidopsis thaliana (thale cress): AT3G49600Help
Entry
AT3G49600         CDS       T00041                                 

Gene name
UBP26
Definition
ubiquitin-specific protease 26
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT3G49600 (UBP26)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT3G49600 (UBP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1067 aa AA seqDB search
MSRPNTRNKNKRQRPDAVDSSSQILRKIHEANDVTDDDINQLFMIWKPVCQGCRVNTRDN
PNCFCGLVPPLNGSRKSGLWQKTSEIIQSLGPDPTLDRRDSESTPAGLTNLGATCYANSI
LQCLYMNTAFREGVFSVEVHVLKQNPVLDQIARLFAQLHASQKSFVDSDAFVKTLELDNG
VQQDTHEFLTLLLSLLERCLLHSGVKAKTIVQDLFSGSVSHVTTCSKCGRDSEASSKMED
FYALELNVKGLKSLDASLNDYLSLEQLNGDNQYFCGSCNARVDATRCIKLRTLPPVITFQ
LKRCIFLPKTTAKKKITSSFSFPQVLDMGSRLAESSQNKLTYDLSAVLIHKGSAVNSGHY
VAHIKDEKTGLWWEFDDEHVSELGKRPCNEASSSTPQSESNGTASSGNITDGIQSGSSDC
RSAIKSEVFSSSDAYMLMYSLRCDKQENQEGQKENPIDITKGEVKQLKGGYLPKHLSEWI
NNMNAVFLESCKQYNLRKEKELNALTERRQEVRTILSEAAVQSLEEQYFWISTDWLRLWA
DTTLPPALDNTPLLCSHGKVHASKVNCMKRISELAWIKLESKFNGGPKLGKGDYCRDCLM
DGARMVVSSDSYRDRRTFMKSIANDVLSGKCEDGMYYISRAWLQQWIKRKNLDAPTEADA
GPTNAITCNHGELMPEQAPGAKRVVVPENFWSFLFEDALKVMSEDTLDCTCFPVDSSQCC
HCTEVLSEVACFEDSLRTLKVKQRQNHEKLATGKGIPLTPQSRYFLLPSPWLVQWRIYIN
MTGKNSSSAPEPERLDGVINTLKCKKHTRLLERLPELVCRRGSYFQKNPSTDKLTIIPEL
DWKYFCDEWGGLMENGISAFIEVGNTDQSSSPDVIDLEKDSSPDDNMDVDAQQLILRASP
EICEECIGERESCELMQKLSYSEGDVFVCFVRGKEAPKAMLEASDSSFEVDRRTSKRSRR
TNYGNLTSLKVSATTTVYQLKMMIWELLGVMKENQELHKGSKVIDQESATLADMNIFPGD
RLWVRDTEMHEHRDIADELCEKKPGAQDIEEGFRGTLLTGNISSEAC
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgagtagacctaacacccgaaacaaaaacaagagacaaagaccagacgctgttgattct
tcttctcagattctccggaaaattcacgaggctaatgatgtaactgatgatgacattaac
caacttttcatgatttggaagccagtttgtcaaggttgtcgtgtaaacactcgtgacaat
cctaactgcttttgtggcttggttccaccgcttaatggaagccggaaatctggtttgtgg
cagaaaacgtcggagattattcagtctcttggtccagatccgaccttggaccgtcgtgat
tctgaatctacacccgctggtctgactaatttgggtgctacttgttatgccaacagtata
cttcagtgtttgtacatgaatactgctttccgagaaggagttttttctgttgaggttcat
gtcttgaagcagaatccagtcttggatcagattgctcggctttttgcacagttgcatgct
agccaaaagtcctttgttgattctgatgcttttgtcaagacgttggagttggataatggg
gttcaacaggatacccatgagttcttgacattgcttctttccttgcttgagcgttgctta
ctccattctggagtcaaagccaaaacaatagttcaagatctcttcagtggtagtgtctcg
catgtcaccacgtgctcaaaatgtgggagggattccgaagcttcgtcaaagatggaggat
ttttatgcccttgagttgaatgttaagggcctcaaatcgttggatgctagtttgaatgat
taccttagcttggagcagcttaatggcgataatcaatatttttgtggaagctgcaatgct
agagtagatgccacacgctgcattaagctgcgcacactacctccggttatcacttttcag
ctcaaacgatgcattttccttcctaagacaacggcgaagaagaaaatcacctcatcattt
tcctttcctcaagtgctggatatgggatcgagattggcagagtcttctcaaaacaaattg
acatacgatctctctgctgtgttaatccacaaaggaagcgctgttaacagcggacattat
gttgctcacataaaagatgaaaagactggcttgtggtgggaatttgatgatgaacatgtg
tcagaactgggtaaacgtccatgtaatgaagcttcttcttcaactccacaatctgagagt
aatggtacggctagtagtgggaatatcacagatggcattcaatcaggctcttcagactgt
aggtctgctattaagtcagaggttttctcatccagtgatgcttatatgctgatgtatagt
cttagatgcgataaacaggaaaatcaggaaggacaaaaagaaaatcctattgacattact
aaaggagaagttaaacagcttaaaggtggttatcttccaaaacatctttctgaatggatc
aataacatgaatgcagtattccttgagagttgcaagcaatataatttaagaaaggaaaaa
gaattgaatgctttgactgaaaggaggcaagaagtacggacaatcctttcagaagctgct
gttcagtcacttgaagaacaatatttttggatctccacagattggcttcgtctatgggct
gataccactttacctcccgctttggacaacacccctttactgtgttcccatgggaaagtt
catgcctcaaaagtgaattgcatgaagcggatatctgaacttgcatggatcaagttagaa
tcaaagttcaatggcggaccaaagttagggaaaggggactactgcagggactgccttatg
gatggtgctcgcatggttgtgtcttctgacagttatagggatcgaagaacattcatgaaa
agcatagcaaatgatgttctttcgggaaagtgcgaggacggaatgtattatatctctaga
gcatggttacagcaatggataaaaaggaaaaatcttgatgctcctactgaagcagatgcg
gggcccacaaatgctattacgtgcaatcatggtgagctgatgccagagcaagcaccaggg
gccaaaagagttgtagttccagagaatttctggtcattcctttttgaagatgctctaaaa
gtgatgtcagaagatactttggattgtacttgttttcctgtggactccagccaatgttgt
cattgcacagaggtactttctgaggttgcatgcttcgaggattcactaagaacattgaag
gtcaagcagcgccaaaatcacgagaagttagccacgggaaagggtataccattaacgcca
caaagccgatatttcttgttgccttctccgtggctagtgcaatggagaatctatattaac
atgactggaaaaaatagttcttcagcaccagagcctgaacgtcttgatggagtcattaat
actctcaaatgcaaaaagcatacacgactccttgaaaggctccctgaacttgtctgcaga
cgtggctcgtattttcagaaaaatccatctacagacaagctaacaatcatccctgagctt
gattggaaatatttctgtgacgagtggggagggctcatggagaatggaatatctgctttt
attgaggttggcaatacagaccaaagttcatccccagacgtcattgaccttgagaaggat
tcttctccggatgataatatggacgttgatgctcaacagcttattctcagggcatcccca
gagatttgcgaggaatgcataggagagagagaaagctgtgagttgatgcagaaacttagt
tactctgagggagatgtatttgtctgttttgtgcgtggaaaggaagctccaaaagcaatg
ttagaggcatctgactctagctttgaggtggatcggcgtacttcaaagcgatctcggaga
acaaattatggaaacctgacaagcctgaaagtgtctgcgacaacgactgtataccaatta
aagatgatgatatgggaattacttggggtgatgaaggaaaaccaggaactccacaaaggc
tcaaaagtgattgatcaggaatctgcaacccttgcagacatgaacatattccccggcgac
aggctttgggtgagagatacagagatgcatgaacaccgcgatattgctgatgagttatgt
gaaaagaaaccgggggctcaagatatcgaagaagggtttcgagggacgctattgactggg
aatatctcttctgaagcctgctag

DBGET integrated database retrieval system