KEGG   Arabidopsis thaliana (thale cress): AT3G50000Help
Entry
AT3G50000         CDS       T00041                                 

Gene name
CKA2
Definition
(RefSeq) casein kinase II, alpha chain 2
  KO
K03097  
casein kinase II subunit alpha [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ribosome biogenesis in eukaryotes
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    AT3G50000 (CKA2)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT3G50000 (CKA2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G50000 (CKA2)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: Other group
  CK2 family
   AT3G50000 (CKA2)
Ribosome biogenesis [BR:ath03009]
 Eukaryotic Type
  90S particles
   Kinase
    AT3G50000 (CKA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 403 aa AA seqDB search
MHLIFFFSYFLRRYLLLLCAILILRAPLAHSLIPPLTCVNTGTVESDVTGIRFDRCLDTD
SLAKISLSTVMSKARVYTDVNVIRPKDYWDYESLNVQWGEQDDYEVVRKVGRGKYSEVFE
GINMNNNEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTPSLIFEY
VNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLID
WGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYG
HDNQDQLVKIAKVLGTDELNAYLNKYQLELDTQLEALVGRHSRKPWSKFINADNRHLVSP
EAIDYLDKLLRYDHQDRLTAKEAMAHPYFAQVRAAESSRMRTQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcacctaatcttcttcttctcctactttcttcgacggtacctgttgttattgtgcgcc
atcttgatcttacgtgcgccgttggcgcattctcttataccaccattaacgtgcgtcaac
accggaaccgttgaatcagacgttactggtatcaggttcgatcgttgcctcgataccgat
tctctcgccaagatctctctttccaccgtcatgtcgaaagctcgtgtttataccgatgtt
aacgtgatccgacctaaggattattgggattacgaatctctcaatgttcagtggggggag
caagatgattacgaggtagtgaggaaggtggggagagggaaatacagtgaggtttttgag
gggattaacatgaataacaatgagaagtgtattatcaagattctcaagcctgttaagaag
aagaagattagaagggagattaaaatacttcagaatctttgtggagggccaaatattgta
aagctgcttgatgttgtcagagatcaacactcaaaaacgccaagcttgatatttgagtat
gtaaacagcacagactttaaggttctgtatccaacattgactgattatgacattcgctac
tacatctatgagctgttgaaggctttggacttctgccactcacaaggaataatgcacaga
gatgtcaagccacacaatgtcatgatcgaccatgagctgcgcaaacttcgcctaatagat
tggggtctcgctgagttttatcatcctggaaaagagtacaacgtccgtgtggcctcaaga
tacttcaaaggtcccgaacttctagttgatttacaggactatgactattccttggacatg
tggagcctcggttgcatgtttgctgggatgatattccgcaaggaacctttcttctatggc
catgacaaccaggatcagctcgtcaaaattgccaaggtactcggaactgatgaattgaat
gcatatctgaataagtatcagttagaacttgatactcaactagaggcacttgttgggaga
catagcaggaagccttggtccaaattcatcaacgctgacaataggcatttggtctcacct
gaggcgattgattatttggacaagctgctccggtatgatcatcaagacagattaactgca
aaagaagcaatggctcatccctatttcgctcaagtcagggcagcagaaagcagcagaatg
aggactcaatag

DBGET integrated database retrieval system