KEGG   Arabidopsis thaliana (thale cress): AT3G50890Help
Entry
AT3G50890         CDS       T00041                                 

Gene name
HB28
Definition
(RefSeq) homeobox protein 28
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 249 aa AA seqDB search
MELGGKCNAITTTTMISTEVKPHTDPEPEAKPESDPSMALFPIKKENQKPKTRVDQGAKY
RECQKNHAASTGGHVVDGCCEFMAGGEEGTLGALKCAACNCHRSFHRKEVYGHRNSKQDH
QLMITPAFYSSNSSYKPRVMHPTGEIGRRTSSSSEDMKKILSHRNQNVDGKSLMMMMMRK
KKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCRMVNLRRQVFKVWMHNNKQAM
KRNNSNISE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagcttggaggaaaatgcaatgcaattacaaccacaacaatgatctcaacagaagta
aagccacatacggatccggaaccagaagccaaacccgaatcagatccatccatggcttta
ttcccgatcaagaaagaaaaccaaaaaccaaagacacgtgtcgaccaaggagctaagtac
cgggaatgtcagaagaaccacgcggcctcaaccggaggacacgtggtggacggatgctgc
gagttcatggccggcggagaagaaggtacactcggtgctttaaaatgcgccgcctgtaac
tgtcaccggagcttccaccggaaagaagtgtacggacacaggaacagtaaacaagatcat
cagctgatgataactccggcgttttacagcagtaacagctcgtacaagccacgtgtaatg
catccaacgggtgagattggacggaggacttcatcttcaagcgaggatatgaagaagatt
ctgagtcatcgtaaccaaaacgttgatgggaaaagtttgatgatgatgatgatgaggaag
aagaagagagtgaggacaaagatcaatgaagaacaaaaggagaagatgaaggaatttgca
gagagattagggtggaggatgcagaagaaagatgaagaagagattgataagttttgtagg
atggtgaatctgaggagacaagtttttaaggtttggatgcataataacaagcaagcaatg
aagagaaacaatagtaacattagtgaatag

DBGET integrated database retrieval system