KEGG   Arabidopsis thaliana (thale cress): AT3G50890Help
Entry
AT3G50890         CDS       T00041                                 

Gene name
HB28
Definition
(RefSeq) homeobox protein 28
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: ZF-HD_dimer Homeobox
Motif
Other DBs
NCBI-GeneID: 824253
NCBI-ProteinID: NP_190658
MIPS: AT3G50890.1
TAIR: AT3G50890
Araport: AT3G50890
UniProt: Q9SVL0 A0A178VL56
Position
3
AA seq 249 aa AA seqDB search
MELGGKCNAITTTTMISTEVKPHTDPEPEAKPESDPSMALFPIKKENQKPKTRVDQGAKY
RECQKNHAASTGGHVVDGCCEFMAGGEEGTLGALKCAACNCHRSFHRKEVYGHRNSKQDH
QLMITPAFYSSNSSYKPRVMHPTGEIGRRTSSSSEDMKKILSHRNQNVDGKSLMMMMMRK
KKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCRMVNLRRQVFKVWMHNNKQAM
KRNNSNISE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagcttggaggaaaatgcaatgcaattacaaccacaacaatgatctcaacagaagta
aagccacatacggatccggaaccagaagccaaacccgaatcagatccatccatggcttta
ttcccgatcaagaaagaaaaccaaaaaccaaagacacgtgtcgaccaaggagctaagtac
cgggaatgtcagaagaaccacgcggcctcaaccggaggacacgtggtggacggatgctgc
gagttcatggccggcggagaagaaggtacactcggtgctttaaaatgcgccgcctgtaac
tgtcaccggagcttccaccggaaagaagtgtacggacacaggaacagtaaacaagatcat
cagctgatgataactccggcgttttacagcagtaacagctcgtacaagccacgtgtaatg
catccaacgggtgagattggacggaggacttcatcttcaagcgaggatatgaagaagatt
ctgagtcatcgtaaccaaaacgttgatgggaaaagtttgatgatgatgatgatgaggaag
aagaagagagtgaggacaaagatcaatgaagaacaaaaggagaagatgaaggaatttgca
gagagattagggtggaggatgcagaagaaagatgaagaagagattgataagttttgtagg
atggtgaatctgaggagacaagtttttaaggtttggatgcataataacaagcaagcaatg
aagagaaacaatagtaacattagtgaatag

DBGET integrated database retrieval system