KEGG   Arabidopsis thaliana (thale cress): AT3G51030Help
Entry
AT3G51030         CDS       T00041                                 

Gene name
TRX1
Definition
(RefSeq) thioredoxin H-type 1
  KO
K03671  thioredoxin 1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AT3G51030 (TRX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_7 Thioredoxin_9 Thioredoxin_2 Thioredoxin_8 Redoxin OST3_OST6 AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 824267
NCBI-ProteinID: NP_190672
MIPS: AT3G51030.1
TAIR: AT3G51030
Araport: AT3G51030
UniProt: P29448 A0A178VFN9
Structure
PDB: 

Jmol
Position
3
AA seq 114 aa AA seqDB search
MASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNV
LFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggaagaaggacaagtgatcgcctgccacaccgttgagacatggaacgagcag
cttcagaaggctaatgaatccaaaactcttgtggtggttgatttcacggcttcttggtgt
ggaccatgtcgtttcatcgctccattctttgctgatttggctaagaaacttcctaacgtg
cttttcctcaaggttgatactgatgaattgaagtcggtggcaagtgattgggcgatacag
gcgatgccaaccttcatgtttttgaaggaagggaagattttggacaaagttgttggagcc
aagaaagatgagcttcagtctaccattgccaaacacttggcttaa

DBGET integrated database retrieval system