KEGG   Arabidopsis thaliana (thale cress): AT3G51840Help
Entry
AT3G51840         CDS       T00041                                 

Gene name
ACX4
Definition
(RefSeq) acyl-coenzyme A oxidase 4
  KO
K00232  
acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Peroxisome
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AT3G51840 (ACX4)
  Lipid metabolism
   00071 Fatty acid degradation
    AT3G51840 (ACX4)
   00592 alpha-Linolenic acid metabolism
    AT3G51840 (ACX4)
   01040 Biosynthesis of unsaturated fatty acids
    AT3G51840 (ACX4)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AT3G51840 (ACX4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT3G51840 (ACX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 436 aa AA seqDB search
MAVLSSADRASNEKKVKSSYFDLPPMEMSVAFPQATPASTFPPCTSDYYHFNDLLTPEEQ
AIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIKGYGCPGLSITANAI
ATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNG
SDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTNQINGFIVKKDAPGLK
ATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVLAVSRVMVAWQPIGISM
GIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLCKLYETGQMTPGQ
ASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGR
EVTGIASFKPATRSRL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctttcatctgcagatcgagctagtaatgagaagaaggtgaagagttcatac
tttgatttgccacctatggaaatgtctgtagcatttcctcaagcaactccagcctctaca
tttccaccttgtacttcagactattatcatttcaatgatctactgactccggaagaacaa
gctatccggaagaaagtgagggaatgcatggagaaagaagttgctccaataatgacagag
tactgggagaaagcagaatttccattccatatcactccaaagcttggggctatgggtgtt
gctggtggctcgatcaagggttatggatgtcctggtctctccatcaccgccaatgcaatt
gccacagcagaaatagctagagttgatgcaagttgttcgactttcattttggtgcattct
tctttgggcatgctcactattgcactctgtggatcagaagcacagaaggagaagtatttg
ccttctttggctcaattgaatactgtggcttgttgggctttgacagagcccgacaatgga
agcgatgcaagtggtctaggaacgactgcaacaaaggttgaaggaggttggaaaattaat
ggacaaaagcgttggattggaaacagcacctttgcagatctgttgatcatctttgcgagg
aatacaacaactaaccaaatcaacggattcatagtcaagaaagatgcgcctggcctaaag
gctactaagatcccaaataaaataggtttacgtatggttcaaaatggagatattctacta
cagaatgtctttgttccagatgaggatcggttacctggggtaaattcttttcaggacacc
agcaaggttctggctgtctcacgtgtaatggtggcctggcaaccaatcggcatatcaatg
ggaatctacgatatgtgccacaggtatctgaaggagaggaaacagtttggagcaccgttg
gctgctttccagttaaaccaacagaagcttgtgcagatgctgggtaacgttcaagcgatg
tttctaatgggttggcgtctctgcaagctgtatgagacgggtcagatgactccaggtcaa
gccagtttaggaaaggcatggatttcatcaaaagcgagagaaactgcttcgctaggtcgg
gaattacttggtgggaatggaattctagcagattttctggtagcaaaggctttctgtgac
cttgaacccatttatacatacgaagggacttatgatataaacaccttagtaacagggagg
gaagtaacgggtattgcgagtttcaaaccggctacacgtagccgtctctaa

DBGET integrated database retrieval system