KEGG   Arabidopsis thaliana (thale cress): AT3G52200Help
Entry
AT3G52200         CDS       T00041                                 

Gene name
LTA3
Definition
dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT3G52200 (LTA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G52200 (LTA3)
   00020 Citrate cycle (TCA cycle)
    AT3G52200 (LTA3)
   00620 Pyruvate metabolism
    AT3G52200 (LTA3)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AT3G52200 (LTA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 713 aa AA seqDB search
MVLPLFRRAAIARTSSLLRARLFAPASEFHSRFSNGLYHLDDKISSSNGVRSASIDLITR
MDDSSPKPILRFGVQNFSSTAIRLTNTDVKWVIRIINGNFRLTCRKIEMLIDAGAKTSIS
LFSLMFVLPSYLRYSDRRCNQLYKILPLNYYFLWVVGPISQTVLAMPALSPTMSHGNVVK
WMKKEGDKVEVGDVLCEIETDKATVEFESQEEGFLAKILVTEGSKDIPVNEPIAIMVEEE
DDIKNVPATIEGGRDGKEETSAHQVMKPDESTQQKSSIQPDASDLPPHVVLEMPALSPTM
NQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEGSKDVAVGKPI
ALIVEDAESIEAIKSSSAGSSEVDTVKEVPDSVVDKPTERKAGFTKISPAAKLLILEHGL
EASSIEASGPYGTLLKSDVVAAIASGKASKSSASTKKKQPSKETPSKSSSTSKPSVTQSD
NNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDPLLAFRKELQENHGVKVSVNDI
VIKAVAVALRNVRQANAFWDAEKGDIVMCDSVDISIAVATEKGLMTPIIKNADQKSISAI
SLEVKELAQKARSGKLAPHEFQGGTFSISNLGMYPVDNFCAIINPPQAGILAVGRGNKVV
EPVIGLDGIEKPSVVTKMNVTLSADHRIFDGQVGASFMSELRSNFEDVRRLLL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttccgctcttccggcgcgctgcgatcgcccggacttcctcgcttctcagagct
cgtcttttcgctcctgcctccgaattccattctcgcttttctaatggactataccacttg
gacgacaaaattagtagcagtaatggtgtgaggtctgcctctatagacttgattacaaga
atggatgatagttctccaaagcccattctgcgatttggcgtgcaaaacttttcatctaca
gccataagacttaccaacacagatgttaagtgggtgataagaataattaatggaaacttt
cgcttaacttgtagaaaaatagaaatgttaattgatgcaggtgcaaaaacttccatatca
ctcttttctctgatgtttgtgcttccatcataccttagatacagcgacaggagatgcaat
caattatacaagattcttccattaaattattattttctttgggttgtaggacccatatca
cagacggttcttgcaatgccagccttgtctcctactatgagtcatggaaatgttgtaaaa
tggatgaagaaagaaggtgacaaggtagaggtgggtgatgtactatgtgagatagagaca
gacaaagccactgtagaatttgagagtcaagaggaaggatttctggccaagattttagtc
actgaaggatcaaaggatatccctgttaatgaaccgattgcaataatggttgaggaggaa
gacgacattaaaaacgttcctgctaccatagagggtggacgagatggtaaagaggaaaca
tcagctcatcaagtgatgaaacctgacgaaagcacacaacaaaaaagttccattcagccc
gatgcatcagatcttcccccacatgtcgtcttagaaatgccagcactttctcctacaatg
aaccaaggtaatattgccaaatggtggaaaaaagagggtgacaagattgaagtgggtgat
gtcataggtgagatcgagactgacaaagccactctggaatttgaaagccttgaagagggg
tacttagctaagattctaattcctgaaggttccaaggatgtggcggtgggaaagccgatt
gccctaatagttgaagatgctgaaagtattgaagccatcaagtcttcttccgcaggtagt
tctgaggttgatacagttaaagaagtccctgacagtgttgtagataaacctacagagagg
aaagcaggcttcacaaagatcagtcctgctgcaaagctattgattttagaacatggattg
gaggcatcatcaattgaggcatcgggtccctatggtacattattgaaatcagacgttgtg
gccgcaattgcttctggaaaagcttctaaatcatctgcgtctacgaagaagaagcaacca
tcaaaggagaccccgtctaaatcctcctccacatcgaagccttctgtgacacagtcagat
aataattatgaagattttccaaatagtcaaattcgcaagattatagcaaaacgtttattg
gaatcaaaacagaagataccccatttgtatttacaatcagatgttgtattggatcctctt
cttgcatttagaaaagaacttcaagaaaaccatggcgttaaagtgtctgtcaatgacata
gttattaaagcagtggcagtcgcactgaggaatgtacgacaagctaatgctttctgggat
gctgagaaaggagatatcgttatgtgtgacagtgttgacatatcaattgcagttgcaact
gagaagggcttaatgactccaattatcaagaatgcagaccagaaatctatttctgctatt
tccttagaggttaaggagctggcacaaaaggctcgatctggaaagcttgctcctcatgag
tttcaaggagggacattcagcatatcaaatctaggaatgtatcctgtggataatttctgc
gcaatcattaacccccctcaggctgggattctagcagttggtagaggaaacaaagtggtt
gagccagttattggactagatggaattgagaagccttctgttgtgacaaaaatgaatgta
acgttatccgctgatcatcggatctttgatggacaagttggagcttcgtttatgtctgaa
ttgcgttcaaactttgaggatgttcgaagacttcttctgtga

DBGET integrated database retrieval system