KEGG   Arabidopsis thaliana (thale cress): AT3G52525Help
Entry
AT3G52525         CDS       T00041                                 

Gene name
OFP6
Definition
(RefSeq) ovate family protein 6
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Ovate
Motif
Other DBs
NCBI-GeneID: 824418
NCBI-ProteinID: NP_680125
MIPS: AT3G52525.1
TAIR: AT3G52525
Araport: AT3G52525
UniProt: Q3EAL1 A0A178VIE0
Position
3
AA seq 159 aa AA seqDB search
MATKSKKKILKTVSVVDISCGNCIKPTFASIFNFFSKKPKRPSSTYRHCHSSISSATPSS
TPLATASVAVEKDSDDPYLDFRQSMLQMILENQIYSKDELRELLQCFLSLNSHYHHGIIV
RAFSEIWEDVSSAAASAVEASPLITRHVSRASRDYYNYY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcgactaaaagcaagaagaagatcctgaagactgtatctgttgtcgacatcagctgc
ggcaactgtataaaaccaactttcgcctctattttcaactttttctccaaaaagcctaaa
cgtccctcgtctacttaccgtcactgccactcctccatctcctccgccacaccctcctcc
acgcctttggccaccgcatccgtcgccgtggagaaagattctgacgatccgtacctagat
ttccggcagtctatgcttcaaatgatactagagaaccagatttactcgaaagatgaactt
agagagcttcttcaatgtttcctcagcctcaattctcactatcatcacggcatcatcgtc
cgtgccttctcggaaatatgggaagacgtttcctccgccgctgcttccgccgtcgaagcg
tcccctctcatcacccgtcatgtgtcacgtgcgtcacgtgattactataactattactag

DBGET integrated database retrieval system