KEGG   Arabidopsis thaliana (thale cress): AT3G53650Help
Entry
AT3G53650         CDS       T00041                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G53650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 138 aa AA seqDB search
MAPKAAEKKPAGKKPAEKAPAEKLPKAEKKITKEGGSEKKKKKSKKNIETYKIYIFKVLK
QVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGEL
SKHAVSEGTKAVTKFTSS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaaagcggcagagaagaaaccggctgggaagaagccagcagaaaaagctccg
gcagagaaattaccaaaggcggagaagaagatcaccaaggaaggtggaagcgaaaagaag
aagaagaaatcgaagaagaacatcgagacgtacaagatctacatcttcaaggttctgaaa
caagttcatcctgatatcggaatctccgggaaagcgatggggatcatgaacagtttcatc
aacgacatcttcgagaaactagctcaggaatcatcgcgattggctaggtacaacaagaaa
ccgacgatcacttctcgggaaattcagacggcggtgagacttgtgttgcctggagagctc
tcgaaacacgctgtttctgaaggcactaaggcggttactaaattcactagctcgtag

DBGET integrated database retrieval system