KEGG   Arabidopsis thaliana (thale cress): AT3G53650Help
Entry
AT3G53650         CDS       T00041                                 

Definition
(RefSeq) Histone superfamily protein
  KO
K11252  histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AT3G53650
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G53650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa RAMP4
Motif
Other DBs
NCBI-GeneID: 28719403
NCBI-ProteinID: NP_001319739
MIPS: AT3G53650.1
TAIR: AT3G53650
Araport: AT3G53650
UniProt: Q9LFF6 A0A178VGH6
Position
3
AA seq 138 aa AA seqDB search
MAPKAAEKKPAGKKPAEKAPAEKLPKAEKKITKEGGSEKKKKKSKKNIETYKIYIFKVLK
QVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGEL
SKHAVSEGTKAVTKFTSS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaaagcggcagagaagaaaccggctgggaagaagccagcagaaaaagctccg
gcagagaaattaccaaaggcggagaagaagatcaccaaggaaggtggaagcgaaaagaag
aagaagaaatcgaagaagaacatcgagacgtacaagatctacatcttcaaggttctgaaa
caagttcatcctgatatcggaatctccgggaaagcgatggggatcatgaacagtttcatc
aacgacatcttcgagaaactagctcaggaatcatcgcgattggctaggtacaacaagaaa
ccgacgatcacttctcgggaaattcagacggcggtgagacttgtgttgcctggagagctc
tcgaaacacgctgtttctgaaggcactaaggcggttactaaattcactagctcgtag

DBGET integrated database retrieval system