KEGG   Arabidopsis thaliana (thale cress): AT3G53830Help
Entry
AT3G53830         CDS       T00041                                 

Definition
(RefSeq) Regulator of chromosome condensation (RCC1) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 472 aa AA seqDB search
MNGNIVGKVPIGECKATVVYMSGYLPGAASEKSPILSPVPVRLSAAVHGGDSWKDVCGGG
CGFAMAISEKGKLITWGSTDDEGQSYVASGKHGETPEPFPLPTEAPVVQASSGWAHCAVV
TETGEAFTWGWKECIPSKDPVGKQQSGSSEQGDIASQGSNAASGTTLQNENQKVGEESVK
RRRVSTAKDETEGHTSGGDFFATTPSLVSVGLGVRITSVATGGRHTLALSDLGQIWGWGY
GGEGQLGLGSRIKMVSSPHLIPCLESIGSGKERSFILHQGGTTTTSAQASREPGQYIKAI
SCGGRHSAAITDAGGLITFGWGLYGQCGHGNTNDQLRPMAVSEVKSVRMESVAAGLWHTI
CISSDGKVYAFGGNQFGQLGTGTDHAEILPRLLDGQNLEGKHAKAVSCGARHSAVLAEDG
QLLCWGWNKYGQLGLGDTNDRNIPTQVQLDGCRLRKVACGWWHTLLLGDSPT
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggaatattgtaggaaaggttccgattggggaatgtaaagcgactgtagtttac
atgtccggttacttaccaggagctgcgtcggagaaatccccgattctctcccctgttccc
gtgcgtttatcggcggctgttcacggtggagattcgtggaaagatgtatgtggtggtggt
tgtggattcgctatggctatttcagagaaaggaaagcttataacttggggttctactgat
gatgaaggacagagctatgtggcttctgggaagcatggggaaactccagagccgtttcct
cttcctacggaggctccagtcgttcaggcttcttcaggatgggcacattgtgcggttgta
acagagactggtgaagcatttacttggggttggaaggagtgcattccatcaaaggatcct
gttggaaagcagcagagtggctcaagtgagcaaggtgatatcgcatcacaaggttcaaat
gcggctagtggtacgacactacagaatgagaaccaaaaggtaggggaggaatcagtgaag
cggagacgggtttcaactgccaaagatgaaactgaaggccatacatctggaggcgacttc
tttgctacaacaccttcacttgtgagtgttggccttggagtgaggatcaccagtgttgct
actggtggtcggcatacgctggcattgtcagatttaggacagatttggggttggggatat
ggaggcgaaggtcaactaggattgggttcccggattaaaatggtgtcatctcctcatcta
ataccttgccttgaatcaattggatctggaaaagaaagatctttcatattacatcaagga
ggaacaacaaccacgtctgctcaagcttctagagaacctggtcagtacatcaaggccatt
tcatgtggaggtcgtcatagcgcagcaattacagatgctggcgggttaataacttttggc
tggggactctatggacagtgtggccacggaaacacaaatgaccagttaaggcccatggct
gtgtcagaagtgaagagtgttcggatggaaagcgtagcagctggattgtggcacactatt
tgcatctctagtgatggtaaagtgtatgccttcggtggaaaccaatttgggcaactggga
actggtactgatcatgctgagatattaccgaggttgctggatggccagaatttggagggc
aaacatgcaaaagcagttagttgcggcgcgcgacatagtgcggttttggcagaagatggt
cagttgctatgctggggatggaacaaatatggacagctgggtctaggggacacgaatgac
cggaacattcctacacaagtccagctggatggctgcagactgagaaaagtggcgtgtgga
tggtggcatacattgctactaggagattcacccacttga

DBGET integrated database retrieval system