KEGG   Arabidopsis thaliana (thale cress): AT3G54340Help
Entry
AT3G54340         CDS       T00041                                 

Gene name
AP3
Definition
(RefSeq) Floral homeotic protein APETALA 3
  KO
K09264  
MADS-box transcription factor, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, Homeotic genes
    AT3G54340 (AP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 232 aa AA seqDB search
MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP
NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE
LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV
DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagggaagatccagatcaagaggatagagaaccagacaaacagacaagtgacg
tattcaaagagaagaaatggtttattcaagaaagcacatgagctcacggttttgtgtgat
gctagggtttcgattatcatgttctctagctccaacaagcttcatgagtatatcagccct
aacaccacaacgaaggagatcgtagatctgtaccaaactatttctgatgtcgatgtttgg
gccactcaatatgagcgaatgcaagaaaccaagaggaaactgttggagacaaatagaaat
ctccggactcagatcaagcagaggctaggtgagtgtttggacgagcttgacattcaggag
ctgcgtcgtcttgaggatgaaatggaaaacactttcaaactcgttcgcgagcgcaagttc
aaatctcttgggaatcagatcgagaccaccaagaaaaagaacaaaagtcaacaagacata
caaaagaatctcatacatgagctggaactaagagctgaagatcctcactatggactagta
gacaatggaggagattacgactcagttcttggataccaaatcgaagggtcacgtgcttac
gctcttcgtttccaccagaaccatcaccactattaccccaaccatggccttcatgcaccc
tctgcctctgacatcattaccttccatcttcttgaataa

DBGET integrated database retrieval system