KEGG   Arabidopsis thaliana (thale cress): AT3G54440Help
Entry
AT3G54440         CDS       T00041                                 

Definition
glycoside hydrolase family 2 protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT3G54440
  Lipid metabolism
   00600 Sphingolipid metabolism
    AT3G54440
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AT3G54440
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AT3G54440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1108 aa AA seqDB search
MVSLATQMILPSENGYRVWEDQTLFKWRKRDPHVTLRCHESVQGALRYWYQRNNVDLTVS
KSAVWNDDAVQAALDSAAFWVDGLPFVKSLSGYWKFFLAPKPANVPDKFYDAAFSDSDWN
ALQVPSNWQCHGFDRPIYTNVVYPFPNDPPYVPEDNPTGCYRTYFQIPKEWKDRRILLHF
EAVDSAFFAWINGNPVGYSQDSRLPAEFEISDYCYPWDSGKQNVLAVQVFRWSDGSYLED
QDHWWLSGIHRDVLLLAKPKVFIADYFFKSKLADDFSYADIQVEVKIDNMQESSKDLVLS
NFIIEAAIFDTKNWYNSEGFSCELSPKVANLKLNPSPSPTLGFHGYLLEGKLDSPNLWSA
EQPNVYILVLTLKDTSGKVLDSESSIVGIRQVSKAFKQLLVNGHPVVIKGVNRHEHHPRV
GKTNIEACMVKDLIMMKEYNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIETHGFDLS
GHLKHPAKEPSWAAAMLDRVVGMVERDKNHTCIISWSLGNEAGYGPNHSAMAGWIREKDP
SRLVHYEGGGSRTSSTDIVCPMYMRVWDIIKIALDQNESRPLILCEYQHAMGNSNGNIDE
YWEAIDNTFGLQGGFIWDWVDQGLLKLGSDGIKRWAYGGDFGDQPNDLNFCLNGLIWPDR
TPHPALHEVKHCYQPIKVSLTDGMIKVANTYFFNTTEELEFSWTIHGDGLELGSGTLSIP
VIKPQNSFEMEWKSGPWFSFWNDSNAGELFLTINAKLLNLTRSLEAGHLLSSTQIPLPAK
GQIIPQAIKKTDTSITCETVGDFIKISQKDSWELMVNVRKGTIEGWKIQGVLLMNEAILP
CFWRAPTDNDKGGGDSSYFSRWKAAQLDNVEFLVESCSVKSITDKSVEIEFIYLGSSASG
SSKSDALFKVNVTYLIYGSGDIITNWFVEPNSDLPPLPRVGIEFHIEKTLDRVEWYGKGP
FECYPDRKAAAHVAIYEHNVGDMHVPYIVPGENGGRTDVRWVTFRNKDGVGIYASTYGSS
SLMQMNASYYTTGELHRATHEEDLIKGQNIEVVHLDHKHMGLGGDDSWTPCVHDKFLIPP
AQYSFSLRLCPITASTSGLNIYKDQLPC
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgttagcgacccaaatgattcttccatctgaaaatgggtatagagtttgggag
gatcagacccttttcaaatggcgtaagagagatcctcatgtcaccttgcgttgccatgaa
tccgtccaaggggctttgaggtactggtatcagcggaacaacgtggatctcaccgtatca
aaatctgctgtttggaatgatgatgctgttcaagctgctcttgatagcgctgctttttgg
gttgacggcttgccctttgttaagtctttatctggttactggaagtttttcttggctcct
aaacctgctaatgttcctgacaaattttatgatgctgccttttctgattcagactggaat
gctttacaggttccttccaactggcagtgtcatggatttgatcggcctatctatacgaat
gtggtgtaccctttcccgaatgatcctccttatgttcctgaggataatcctactggttgc
tacagaacctacttccagattcccaaagaatggaaggacagaagaatacttcttcacttt
gaagctgtagactccgcattctttgcttggataaatggcaaccctgttgggtacagtcaa
gacagcaggttacctgctgaatttgaaatatctgattattgctatccatgggactcggga
aaacaaaatgttcttgctgttcaagtctttagatggagtgatggttcataccttgaagac
caagatcattggtggttgtctggtattcatcgagatgtgcttttgttagcaaagcccaag
gtcttcattgctgactactttttcaagtcaaaattggcagatgacttttcatacgcagac
atccaggttgaagtgaagattgacaatatgcaggagtcctcaaaggatcttgttctttct
aacttcatcatagaggctgccatatttgatacaaaaaattggtacaactctgaaggattt
agttgtgaactttctcccaaggtggctaatttgaagcttaatccttctccaagcccaact
cttggatttcatggttacttgcttgagggaaaactggattcgccaaatctctggtcagct
gaacaaccaaatgtttacatcctcgttttaactctaaaagatacatctgggaaagtcctt
gattctgaatcaagcattgtgggcattcggcaagtatcaaaggcctttaaacagcttctt
gttaatgggcacccagtcgtgataaaaggtgtaaacaggcatgagcaccatccacgtgtt
gggaagacgaatatagaggcatgcatggtcaaggatttaattatgatgaaagaatataat
atcaatgcggtgcgaaacagtcattatcctcaacatccccgctggtatgaattatgtgat
ttgttcggcatgtacatgatcgatgaagccaatatagagacacatggttttgatctctct
gggcatctgaagcaccctgcaaaagagccaagctgggcagctgctatgctggatcgagta
gttgggatggttgaaagagacaaaaaccatacatgcataatttcttggtcacttggaaat
gaggctggctatgggcccaatcattctgccatggcaggttggattagggaaaaggacccc
tcacggttggtgcactatgaaggtggtggttccagaacaagttctacagatatagtctgc
cctatgtacatgcgggtttgggacatcatcaagattgcacttgatcaaaatgaatcacgg
ccgttgatattatgcgagtatcaacatgctatgggtaacagcaacgggaatatagatgag
tactgggaggcaattgacaatacctttggcctgcaaggaggtttcatatgggactgggtt
gaccaggggctattgaaactggggtcagatggcattaagcgttgggcatatggaggggac
tttggtgaccagcctaatgatttgaacttctgtctcaatgggcttatatggcctgaccga
actcctcatccagcactccatgaggttaagcattgttaccaaccaatcaaggtttcattg
acggatggcatgataaaggttgcaaacacttactttttcaacacaacagaagaattggag
tttagctggacaattcatggggatggtcttgaacttggatctgggactctctctattcct
gtgataaagccacaaaatagttttgagatggagtggaagtcaggtccatggttttctttc
tggaatgactcaaatgctggagaattgtttctgacaataaatgccaagcttttaaatctt
actcgttcgcttgaagccggtcatcttttgtcttcaacgcagattcctttaccagcaaag
ggacaaataataccgcaggcgataaaaaagacagacactagtatcacttgtgaaactgtt
ggagatttcattaagatcagccagaaagattcatgggagctaatggtaaatgtccgaaaa
gggactattgaaggttggaagattcaaggagttctccttatgaacgaagctatactgcca
tgcttttggcgagcacctacagacaatgataaaggtggaggtgactctagttatttttcg
aggtggaaagcggcacagttagataatgtggagttccttgttgaaagctgttcagtaaag
agcatcactgataaatccgtagagatagagttcatttaccttggttcttcagcttctggc
tcttcaaagtcagatgccttattcaaagtcaatgtgacatatctgatctatggttccgga
gatatcatcaccaattggtttgtagaaccaaactctgatcttccaccgctaccacgtgta
ggtatagaattccacattgaaaaaacactggaccgtgtagaatggtatggcaaaggtcca
tttgagtgttacccagaccgaaaagcagcagcccatgtggcgatatatgaacacaatgtt
ggagacatgcatgtcccttatattgttccaggagaaaatggaggtagaacagatgttagg
tgggtaacattccgaaacaaagatggtgtaggaatatatgcttcaacatatggtagctct
tctctaatgcaaatgaatgctagttattatacaaccggtgagcttcaccgtgcaacgcat
gaagaggatcttatcaaaggacaaaacatcgaggtagtgcatctggaccacaaacacatg
ggtcttgggggagatgatagctggactccatgtgttcacgataagtttctgattccgcct
gcacagtattcgttttctctcaggctatgcccaattactgcatccacctcgggtttgaac
atctacaaggatcaactcccctgctag

DBGET integrated database retrieval system