KEGG   Arabidopsis thaliana (thale cress): AT3G54610Help
Entry
AT3G54610         CDS       T00041                                 

Gene name
HAG1
Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT3G54610 (HAG1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AT3G54610 (HAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 568 aa AA seqDB search
MDSHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSF
PPSSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIR
TFTAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISG
LVPKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNI
FARQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQ
VKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDY
DGGLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKI
IKVEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLKTMQDHADAWPF
KEPVDSRDVPDYYDIIKDPIDLKVIAKRVESEQYYVTLDMFVADARRMFNNCRTYNSPDT
IYYKCATRLETHFHSKVQAGLQSGAKSQ
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggactctcactcttcccacctcaacgccgccaatcgttcccgcagttctcagactcct
tctccttctcattccgcctccgcctccgtcacttcttctctccacaaacgcaaactcgcc
gccaccacggcagcgaatgcagccgcttctgaagatcacgcccctccttcttcctctttc
cctccttcctccttctctgccgatactcgcgacggcgctttaacctccaacgatgaactc
gagagcatctccgctcgcggcgccgatacagattcagatcctgatgaatcagaggatata
gtcgtggatgatgacgaggacgaatttgctcctgaacaggaccaggactcttctatccgc
acattcaccgccgctcgactcgattccagctctggagtcaacggttcgagtcgcaacact
aaacttaagacggaaagctccacggtgaagcttgagagctctgatggtggaaaagatggt
ggatcatctgtggttgggactggtgtgagtggcactgttggaggaagctcaatctcaggg
ctcgtgccaaaggatgagtctgttaaggtattggctgagaatttccagactagcggagct
tacattgccagagaagaggctttgaaaagagaggagcaagcaggacgactcaaatttgtt
tgttactcaaatgattccattgatgagcatatgatgtgcttgattgggttgaagaacatt
tttgcaagacagttacctaatatgcccaaggagtacattgttcgtcttctgatggatagg
aaacataagtctgttatggtactaagagggaatctagttgtaggtggtatcacgtatcgt
ccatatcacagtcagaagtttggggaaatagcattttgtgcaatcacagcagatgaacaa
gtaaaaggttacggtaccagattgatgaaccacttgaaacaacatgcacgtgatgttgat
ggattgacgcattttcttacttatgctgacaacaatgctgttggttacttcgtcaagcag
ggttttactaaagagatttacttggagaaagatgtatggcatgggttcattaaagactat
gatggtggtctccttatggaatgcaaaattgatccaaagctgccatatacggatttgtca
agcatgatacgccagcaaagaaaggcaattgatgaaaggataagagagttatcaaactgt
cagaatgtgtatccaaaaattgagtttctaaagaatgaagctggaattcctagaaagatt
atcaaagttgaggaaatacgtggcttaagggaagctggttggaccccagatcagtggggg
cacactcgtttcaaattattcaatggttctgctgatatggtgacaaatcaaaaacagttg
aatgcactcatgcgtgcgcttttaaagacaatgcaagaccatgctgatgcttggcctttc
aaagaaccagtggattctcgcgatgtccctgattactatgacatcattaaggatcccatt
gatctgaaggtaattgcaaagagggtagagtcggaacagtattacgtgacattggatatg
tttgttgcggatgcgagacggatgtttaacaattgtagaacttacaactcccccgatacc
atttattacaaatgtgcaaccaggttggaaacacacttccatagcaaagtacaagcaggt
ctccaatctggtgctaaatctcaatag

DBGET integrated database retrieval system