KEGG   Arabidopsis thaliana (thale cress): AT3G54610Help
Entry
AT3G54610         CDS       T00041                                 

Gene name
HAG1
Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT3G54610 (HAG1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AT3G54610 (HAG1)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    AT3G54610 (HAG1)
   HAT complexes
    PCAF complex
     AT3G54610 (HAG1)
    STAGA complex
     AT3G54610 (HAG1)
    TFTC complex
     AT3G54610 (HAG1)
    SAGA complex
     AT3G54610 (HAG1)
    SLIK complex
     AT3G54610 (HAG1)
    ADA-HAT complex
     AT3G54610 (HAG1)
    HAT-A2 complex
     AT3G54610 (HAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 568 aa AA seqDB search
MDSHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSF
PPSSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIR
TFTAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISG
LVPKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNI
FARQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQ
VKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDY
DGGLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKI
IKVEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLKTMQDHADAWPF
KEPVDSRDVPDYYDIIKDPIDLKVIAKRVESEQYYVTLDMFVADARRMFNNCRTYNSPDT
IYYKCATRLETHFHSKVQAGLQSGAKSQ
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggactctcactcttcccacctcaacgccgccaatcgttcccgcagttctcagactcct
tctccttctcattccgcctccgcctccgtcacttcttctctccacaaacgcaaactcgcc
gccaccacggcagcgaatgcagccgcttctgaagatcacgcccctccttcttcctctttc
cctccttcctccttctctgccgatactcgcgacggcgctttaacctccaacgatgaactc
gagagcatctccgctcgcggcgccgatacagattcagatcctgatgaatcagaggatata
gtcgtggatgatgacgaggacgaatttgctcctgaacaggaccaggactcttctatccgc
acattcaccgccgctcgactcgattccagctctggagtcaacggttcgagtcgcaacact
aaacttaagacggaaagctccacggtgaagcttgagagctctgatggtggaaaagatggt
ggatcatctgtggttgggactggtgtgagtggcactgttggaggaagctcaatctcaggg
ctcgtgccaaaggatgagtctgttaaggtattggctgagaatttccagactagcggagct
tacattgccagagaagaggctttgaaaagagaggagcaagcaggacgactcaaatttgtt
tgttactcaaatgattccattgatgagcatatgatgtgcttgattgggttgaagaacatt
tttgcaagacagttacctaatatgcccaaggagtacattgttcgtcttctgatggatagg
aaacataagtctgttatggtactaagagggaatctagttgtaggtggtatcacgtatcgt
ccatatcacagtcagaagtttggggaaatagcattttgtgcaatcacagcagatgaacaa
gtaaaaggttacggtaccagattgatgaaccacttgaaacaacatgcacgtgatgttgat
ggattgacgcattttcttacttatgctgacaacaatgctgttggttacttcgtcaagcag
ggttttactaaagagatttacttggagaaagatgtatggcatgggttcattaaagactat
gatggtggtctccttatggaatgcaaaattgatccaaagctgccatatacggatttgtca
agcatgatacgccagcaaagaaaggcaattgatgaaaggataagagagttatcaaactgt
cagaatgtgtatccaaaaattgagtttctaaagaatgaagctggaattcctagaaagatt
atcaaagttgaggaaatacgtggcttaagggaagctggttggaccccagatcagtggggg
cacactcgtttcaaattattcaatggttctgctgatatggtgacaaatcaaaaacagttg
aatgcactcatgcgtgcgcttttaaagacaatgcaagaccatgctgatgcttggcctttc
aaagaaccagtggattctcgcgatgtccctgattactatgacatcattaaggatcccatt
gatctgaaggtaattgcaaagagggtagagtcggaacagtattacgtgacattggatatg
tttgttgcggatgcgagacggatgtttaacaattgtagaacttacaactcccccgatacc
atttattacaaatgtgcaaccaggttggaaacacacttccatagcaaagtacaagcaggt
ctccaatctggtgctaaatctcaatag

DBGET integrated database retrieval system