KEGG   Arabidopsis thaliana (thale cress): AT3G54640Help
Entry
AT3G54640         CDS       T00041                                 

Gene name
TSA1
Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT3G54640 (TSA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT3G54640 (TSA1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT3G54640 (TSA1)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AT3G54640 (TSA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 312 aa AA seqDB search
MAIAFKSGVFFLQSPKSQIGFRHSSPPDSSLSFKRFTPMASLSTSSPTLGLADTFTQLKK
QGKVAFIPYITAGDPDLSTTAEALKVLDACGSDIIELGVPYSDPLADGPVIQAAATRSLE
RGTNLDSILEMLDKVVPQISCPISLFTYYNPILKRGLGKFMSSIRAVGVQGLVVPDVPLE
ETEMLRKEALNNDIELVLLTTPTTPTERMKLIVDASEGFIYLVSSIGVTGARSSVSGKVQ
SLLKDIKEATDKPVAVGFGISKPEHVKQIAGWGADGVIVGSAMVKLLGDAKSPTEGLKEL
EKLTKSLKSALL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgctttcaaatccggcgtcttcttcctccaatccccaaaatctcaaattgga
ttccgccattcttctcctcctgattcatcgctttctttcaagagattcactcccatggct
tctctctccacctcttctcctactctcggtctcgctgatactttcacacagctcaaaaaa
caaggcaaagtagcattcataccatatatcacagctggtgatccggatctctctactact
gctgaagcattgaaagttcttgatgcttgtggttctgacataatcgaattgggtgttcct
tactctgaccctttagctgatggacctgttattcaggctgcggcaacaaggtcgttggag
aggggaacaaacctcgatagcatccttgagatgttggataaggttgttccacaaatatct
tgtccgatttcgttgttcacgtattacaacccgattcttaaacgtgggttggggaagttc
atgtccagcatcagagctgttggtgtacagggacttgtggttcccgatgttcctcttgag
gaaactgagatgctgagaaaagaagccctcaacaacgacattgagctggtcctactcact
acaccaaccacaccaacagagcgaatgaagctaattgttgatgcgtcagaaggatttatt
taccttgtgagctcaattggagtgactggtgcacgatcatctgtaagcggaaaggttcag
tcgctcttgaaggatatcaaagaggcgacagacaagccggtggcagtcggttttggaata
tcaaagccggagcatgtgaaacagatagctggatggggagctgatggagtgatcgtaggc
agtgcaatggtaaagctattgggtgatgcaaagtcgccaactgaaggacttaaggagctt
gagaaactaaccaagtctcttaaatctgctcttctttga

DBGET integrated database retrieval system