KEGG   Arabidopsis thaliana (thale cress): AT3G55120Help
Entry
AT3G55120         CDS       T00041                                 

Gene name
TT5
Definition
(RefSeq) Chalcone-flavanone isomerase family protein
  KO
K01859  chalcone isomerase [EC:5.5.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00941  Flavonoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT3G55120 (TT5)
Enzymes [BR:ath01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     AT3G55120 (TT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chalcone Chalcone_2
Motif
Other DBs
NCBI-GeneID: 824678
NCBI-ProteinID: NP_191072
MIPS: AT3G55120.1
TAIR: AT3G55120
Araport: AT3G55120
UniProt: P41088
Structure
PDB: 

Jmol
Position
3
AA seq 246 aa AA seqDB search
MSSSNACASPSPFPAVTKLHVDSVTFVPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTV
IGVYLEGNAVPSLSVKWKGKTTEELTESIPFFREIVTGAFEKFIKVTMKLPLTGQQYSEK
VTENCVAIWKQLGLYTDCEAKAVEKFLEIFKEETFPPGSSILFALSPTGSLTVAFSKDDS
IPETGIAVIENKLLAEAVLESIIGKNGVSPGTRLSVAERLSQLMMKNKDEKEVSDHSVEE
KLAKEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatccaacgcctgcgcctctccgtcaccgttccccgccgtcacgaagcttcat
gtagactccgtcacgtttgtaccgtccgtcaagtcaccggcctcctccaatccattattc
ctcggcggcgccggtgtccgaggccttgatatccaaggtaaattcgtgatcttcaccgtc
attggagtatacctagagggtaacgccgttccttctctatctgtcaagtggaagggaaaa
actacggaggagctaacagaatctatcccgttcttccgtgaaatagtcaccggtgcgttt
gagaagtttatcaaggtgacaatgaaactgccgttaacgggacaacaatattcggagaaa
gtgacggagaattgtgtggctatatggaaacaattagggctttatacggactgtgaagct
aaagctgtggagaagttcttggagatcttcaaggaagaaacattccctcccggttcatcg
atcctcttcgctctctcccctaccggctctcttacggttgcgttttcgaaagatgatagt
atccctgaaaccgggatcgctgtgatcgagaacaaattgttggcggaggcggttctggaa
tctatcatcgggaagaacggtgtgtcacctggcactaggttaagtgttgcagaaagatta
tctcagctaatgatgaagaacaaggacgaaaaggaagttagtgatcactctgttgaggaa
aaactagccaaagagaactga

DBGET integrated database retrieval system