KEGG   Arabidopsis thaliana (thale cress): AT3G55260Help
Entry
AT3G55260         CDS       T00041                                 

Gene name
HEXO1
Definition
beta-hexosaminidase 1
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ath00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ath00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ath00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ath00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ath00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 541 aa AA seqDB search
MSTNLLRLILLFITLSITSSLSTPSPADSPPYLWPLPAEFSFGNETLSVDPTVTLIVAGN
GGGSLIIRAAFDRYMGIIFKHASGRGSLLSRIRFLKMVEYDITSLKIVVHSDSEELQLGV
DESYTLMVSKKNEQSIVGAATIEANTVYGALRGLETFSQLCAFDYITKSVQIYKAPWYIQ
DKPRFGYRGLLIDTSRHYLPIDVIKQIIESMSFAKLNVLHWHIVDEQSFPLETPTYPNLW
KGAYSRWERYTVEDASEIVRFAKMRGINVMAEVDVPGHAESWGTGYPDLWPSLSCREPLD
VTKNFTFDVISGILADMRKIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYK
YFVLRAQQIAISKNWTPVNWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCIFSN
QGYWYLDHLDVPWEEVYNTEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAA
AAAERMWSTREAVSKGNITLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPLGPGSCYA
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaatcttcttcgtcttattctcctattcatcactttatctatcacttcatct
ctgtcaactccgtcgccggctgattctcctccttatctatggccgttaccggcggagttt
tcgttcggaaacgaaacgctctcggtggatcccaccgtgactctaatcgtagctggaaat
ggcggtggatctctgattattagagctgcgtttgataggtatatgggtataatctttaaa
cacgcttctggtagaggttctctattgtcgaggattagatttctgaaaatggttgagtat
gatatcacttctttgaagatcgttgttcattctgattctgaggagcttcaattgggtgtg
gatgagagttatacattgatggtgtcgaagaagaacgagcaatcgattgttggagcagcc
acgatcgaggctaatacagtttatggtgcacttagaggattggagacatttagccagttg
tgtgcctttgattatataaccaaatctgtgcaaatatataaagcaccatggtatattcaa
gataaacctagatttggataccgcggtctgctgatagatacatcaagacattatttacca
attgatgttattaagcaaataatcgaatccatgtcctttgccaaacttaatgtcctgcat
tggcacattgtagacgagcaatcatttcctcttgaaactcctacatatcctaatttgtgg
aaaggagcttattcgagatgggaacgttatacagttgaggatgcctctgagattgtcagg
tttgccaaaatgagaggtattaatgtcatggctgaagtagatgtccctggccatgcggaa
tcgtggggaactggataccctgatctttggccgtctctgtcttgccgagagccccttgat
gttactaaaaactttacattcgatgtgatttctggcattttagcagatatgagaaagata
ttcccatttgagcttttccacttgggtggtgatgaagttaatacagattgctggaaaaac
acaactcatgttaaagaatggcttcagggtcgcaacttcacgactaaggacgcatataaa
tactttgtactccgagcgcaacagatagctatatcgaaaaattggacacctgtcaactgg
gaagaaaccttcagttcctttggaaaagatcttgatccgcggactgtgattcaaaactgg
ctagtgtctgatatatgtcaaaaagcagtagcaaaaggattcaggtgcattttcagtaac
caaggatattggtacctcgaccatttagatgttccgtgggaagaggtttataacaccgag
cctctaaatggaatcgaggatccttctctccaaaagcttgtcatcggaggagaagtttgc
atgtggggtgaaacagctgatacatccgttgtccttcagaccatttggcctcgtgctgca
gcagctgcagaacggatgtggagcaccagagaggccgtgtcaaaggggaacataacgtta
accgcattgccacgtctacactacttcagatgtctactgaataaccgtggcgttccagcg
gctccagtggataacttttacgcacgaagaccccccttgggacctggctcttgctatgct
cagtga

DBGET integrated database retrieval system