KEGG   Arabidopsis thaliana (thale cress): AT3G55430Help
Entry
AT3G55430         CDS       T00041                                 

Definition
(RefSeq) O-Glycosyl hydrolases family 17 protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_17 X8
Motif
Other DBs
NCBI-GeneID: 824709
NCBI-ProteinID: NP_191103
MIPS: AT3G55430.1
TAIR: AT3G55430
Araport: AT3G55430
UniProt: Q9M2T6
Position
3
AA seq 449 aa AA seqDB search
MAKAPPSISLLLLLCAAVFLTIPAVISAIGVNYGTLGNLPPPTQVANFIKTQTSIDSVKI
FDVNPDILRAFAGTGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGN
EILLTGDNNMINNLLPAMRNLNNALVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRPG
WDKGILAPILAYHRRTKSPFMVNPYPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMF
DALMDSTYSAMKALGYGDVNIVVGETGWPSACDAPWCSPANAAWFNLNIIKRAQGQGTPL
MPNRRFETYIFGLFNEEGKPGPTAERNWGLFRADFSPVYDVGLLRNGQGGGGRPALPAPS
TAGGKWCVARSGATNTQLQDSINWVCGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQ
SHGRTDGACNFSGTGMIVGNNPSNGACKY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcgccaccgtcaatctctcttctcctcctcctctgcgccgccgtattcctc
accatccccgccgtgatctccgccatcggtgttaactacggaactctcggaaacctccca
ccaccgactcaggtggctaactttatcaagacacaaacttcgattgatagcgtcaagatc
ttcgatgtgaatcccgatatcctacgtgccttcgctggaactggtatctccgtcgttgtc
accgttcctaacggtgatattccggcgttggctaacggaagacaagctcgtcggtgggtt
tcggttaacattttgccgtttcatcctcagacgaagattaagtatatctcagtcggaaat
gagattctgctcaccggagataataacatgatcaataatctcttaccggcgatgaggaat
cttaacaacgctttggttcgtgctggtgtcagagatgttaaggttacaaccgcacactca
cttaacatcatagcctatgacctgaccggtgcaccaagcagcggtagattcaggccgggt
tgggacaaaggcatattggctccaatcctagcttaccatcgccgaaccaagtcacctttc
atggttaacccgtacccttactttggttttgaccccaaaaacgtcaacttcgcaattttc
cgaacaccgtacaaggcagtccgtgacccgttcacccgccacgtctacaccaacatgttt
gatgcactcatggactcgacatactcagccatgaaagctcttggatacggtgatgttaac
attgtcgttggcgagactggctggccatctgcttgtgacgcaccttggtgctcgcctgcg
aatgctgcttggttcaacctcaacattatcaaacgtgcacaaggccaagggacacctctc
atgcctaacagacggttcgagacatacattttcggtctcttcaacgaagaaggcaaaccc
ggtccgaccgcagagcgtaactggggacttttccgagcagatttctccccggtttacgat
gttggtcttctccgaaacggacaaggcggtggaggccgcccagcattgcccgcacctagt
actgccggcggtaaatggtgtgtagcgaggtccggggcgacgaatactcagctgcaagac
agtattaattgggtgtgtggtcagggtgttgactgtaaaccgatccaagctggtggttcg
tgctttaacccgagcagtttgaggacgcacgcatcttttgttatgaatgcttatttccag
agccacggccgcactgatggtgcttgtaacttcagtggaactggtatgatcgtagggaac
aacccaagcaatggtgcatgtaagtactaa

DBGET integrated database retrieval system