KEGG   Arabidopsis thaliana (thale cress): AT3G55610Help
Entry
AT3G55610         CDS       T00041                                 

Gene name
P5CS2
Definition
delta 1-pyrroline-5-carboxylate synthase 2
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT3G55610 (P5CS2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AT3G55610 (P5CS2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     AT3G55610 (P5CS2)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AT3G55610 (P5CS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 622 aa AA seqDB search
MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS
GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ
MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPYKDSTGIFWDNDSLA
ALLSLELKADLLILLSDVEGLYTGPPSDSTSKLIHTFIKEKHQDEITFGEKSKLGRGGMT
AKVKAAVNAAYGGVPVIITSGYAAENISKVLRGLRVGTLFHQDAHLWAPVVDTTSRDMAV
AARESSRKLQALSSEDRKQILHDIANALEVNEKTIKAENDLDVAAAQEAGYEESLVARLV
MKPGKISSLAASVRQLAEMEDPIGRVLKKTQVADDLILEKTSSPIGVLLIVFESRPDALV
QIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPETVGGKLIGLVTSREEIPDLLKL
DDVIDLVIPRGSNKLVSQIKNSTKIPVLGHADGICHVYVDKSGKLDMAKRIVSDAKLDYP
AACNAMETLLVHKDLEQNGFLDDLIYVLQTKGVTLYGGPRASAKLNIPETKSFHHEYSSK
ACTVEIVEDVYGAIDHIHQHGR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacggagatcgatcgttcacgcgcgttcgccaaagacgttaagcgtatcgtcgtcaag
gttgggactgcagttgttactgggaaaggtggaagattggctcttggacgtttaggagct
atctgtgaacagcttgcggagttaaactcagatggatttgaggtcattttggtgtcatct
ggtgccgttggtcttggtcgacaaaggcttcgatacagacaattagtcaacagcagtttt
gcagatttacagaagccacaaatggaacttgatgggaaggcttgtgctggtgttgggcag
agcagtctcatggcttactatgagactatgtttgaccagttggatgtgacggttgctcaa
atgcttgtgaccgatagcagttttagagataaggatttcaggaagcaacttagtgaaact
gtcaaagcgatgctgaggatgagggttattccagttttcaatgagaatgatgctataagc
actcgcagagccccctacaaggattctactggtatattttgggataatgacagcttagcc
gctcttctgtcgctagagctgaaagctgatcttttgattcttctaagtgatgttgagggc
ctttacactggccctccaagtgattctacctcaaaattaatacacacattcattaaagaa
aaacaccaggacgagattacttttggcgaaaagtccaaattaggacgagggggtatgact
gcaaaagttaaagctgctgttaatgcagcttatggtggcgttcctgttatcataaccagt
ggatatgcagctgagaatataagtaaagtccttagaggactgcgtgttggtaccctgttc
catcaagatgctcatttatgggctccggtcgtagatactacttctcgtgacatggcagtt
gctgcaagggaaagctcaagaaagcttcaggccttatcttcagaagataggaaacaaatt
ctacacgacattgccaatgcccttgaagtaaatgagaaaacaattaaagctgagaatgat
ttagatgttgctgcagcacaagaagctggatatgaagagtctttggtagctcgcttagtt
atgaagcctgggaagatctcaagccttgcagcttccgttcgccagctagccgaaatggaa
gatccaataggccgtgtattaaagaaaactcaggttgcagatgatcttattttagagaag
acctcatcaccaataggtgttcttctgattgtttttgaatcccggcctgatgcacttgtt
cagatagcttcgcttgcaatccggagtggaaatggtcttctgctgaagggtggaaaggag
gctcgtcgatcaaatgctatcttacacaaggtgatcactgatgcaattccggagactgtt
ggaggtaaactcataggacttgtgacctcaagagaggagattcctgatttgctcaagctt
gatgacgttattgatcttgtgatcccaagaggcagcaacaagcttgtttctcaaataaaa
aactcgacgaaaatcccagtgctaggccatgctgatggaatctgtcatgtatatgttgat
aagtctggtaaactggacatggcaaagcgcattgtttccgatgcaaagttggactatcca
gcagcctgtaatgcgatggaaacccttcttgtacataaagatttggagcagaatggtttt
ctcgatgatcttatttatgttctgcaaaccaaaggcgtcactttgtatggtgggccaaga
gcaagtgcaaaactgaatattccggaaacaaaatcatttcaccacgagtacagttccaag
gcctgcaccgttgaaattgtagaagacgtatatggtgctatagatcatattcaccaacat
ggaaggtaa

DBGET integrated database retrieval system