KEGG   Arabidopsis thaliana (thale cress): AT3G55610Help
Entry
AT3G55610         CDS       T00041                                 

Gene name
P5CS2
Definition
delta 1-pyrroline-5-carboxylate synthase 2
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ath00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 622 aa AA seqDB search
MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS
GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ
MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPYKDSTGIFWDNDSLA
ALLSLELKADLLILLSDVEGLYTGPPSDSTSKLIHTFIKEKHQDEITFGEKSKLGRGGMT
AKVKAAVNAAYGGVPVIITSGYAAENISKVLRGLRVGTLFHQDAHLWAPVVDTTSRDMAV
AARESSRKLQALSSEDRKQILHDIANALEVNEKTIKAENDLDVAAAQEAGYEESLVARLV
MKPGKISSLAASVRQLAEMEDPIGRVLKKTQVADDLILEKTSSPIGVLLIVFESRPDALV
QIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPETVGGKLIGLVTSREEIPDLLKL
DDVIDLVIPRGSNKLVSQIKNSTKIPVLGHADGICHVYVDKSGKLDMAKRIVSDAKLDYP
AACNAMETLLVHKDLEQNGFLDDLIYVLQTKGVTLYGGPRASAKLNIPETKSFHHEYSSK
ACTVEIVEDVYGAIDHIHQHGR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacggagatcgatcgttcacgcgcgttcgccaaagacgttaagcgtatcgtcgtcaag
gttgggactgcagttgttactgggaaaggtggaagattggctcttggacgtttaggagct
atctgtgaacagcttgcggagttaaactcagatggatttgaggtcattttggtgtcatct
ggtgccgttggtcttggtcgacaaaggcttcgatacagacaattagtcaacagcagtttt
gcagatttacagaagccacaaatggaacttgatgggaaggcttgtgctggtgttgggcag
agcagtctcatggcttactatgagactatgtttgaccagttggatgtgacggttgctcaa
atgcttgtgaccgatagcagttttagagataaggatttcaggaagcaacttagtgaaact
gtcaaagcgatgctgaggatgagggttattccagttttcaatgagaatgatgctataagc
actcgcagagccccctacaaggattctactggtatattttgggataatgacagcttagcc
gctcttctgtcgctagagctgaaagctgatcttttgattcttctaagtgatgttgagggc
ctttacactggccctccaagtgattctacctcaaaattaatacacacattcattaaagaa
aaacaccaggacgagattacttttggcgaaaagtccaaattaggacgagggggtatgact
gcaaaagttaaagctgctgttaatgcagcttatggtggcgttcctgttatcataaccagt
ggatatgcagctgagaatataagtaaagtccttagaggactgcgtgttggtaccctgttc
catcaagatgctcatttatgggctccggtcgtagatactacttctcgtgacatggcagtt
gctgcaagggaaagctcaagaaagcttcaggccttatcttcagaagataggaaacaaatt
ctacacgacattgccaatgcccttgaagtaaatgagaaaacaattaaagctgagaatgat
ttagatgttgctgcagcacaagaagctggatatgaagagtctttggtagctcgcttagtt
atgaagcctgggaagatctcaagccttgcagcttccgttcgccagctagccgaaatggaa
gatccaataggccgtgtattaaagaaaactcaggttgcagatgatcttattttagagaag
acctcatcaccaataggtgttcttctgattgtttttgaatcccggcctgatgcacttgtt
cagatagcttcgcttgcaatccggagtggaaatggtcttctgctgaagggtggaaaggag
gctcgtcgatcaaatgctatcttacacaaggtgatcactgatgcaattccggagactgtt
ggaggtaaactcataggacttgtgacctcaagagaggagattcctgatttgctcaagctt
gatgacgttattgatcttgtgatcccaagaggcagcaacaagcttgtttctcaaataaaa
aactcgacgaaaatcccagtgctaggccatgctgatggaatctgtcatgtatatgttgat
aagtctggtaaactggacatggcaaagcgcattgtttccgatgcaaagttggactatcca
gcagcctgtaatgcgatggaaacccttcttgtacataaagatttggagcagaatggtttt
ctcgatgatcttatttatgttctgcaaaccaaaggcgtcactttgtatggtgggccaaga
gcaagtgcaaaactgaatattccggaaacaaaatcatttcaccacgagtacagttccaag
gcctgcaccgttgaaattgtagaagacgtatatggtgctatagatcatattcaccaacat
ggaaggtaa

DBGET integrated database retrieval system