KEGG   Arabidopsis thaliana (thale cress): AT3G55610Help
Entry
AT3G55610         CDS       T00041                                 

Gene name
P5CS2
Definition
(RefSeq) delta 1-pyrroline-5-carboxylate synthase 2
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Module
ath_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AT3G55610 (P5CS2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     AT3G55610 (P5CS2)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AT3G55610 (P5CS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh BtpA DIT1_PvcA
Motif
Other DBs
NCBI-GeneID: 824727
NCBI-ProteinID: NP_191120
MIPS: AT3G55610.1
TAIR: AT3G55610
Araport: AT3G55610
UniProt: P54888 A0A178VF78
Position
3
AA seq 726 aa AA seqDB search
MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS
GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ
MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPYKDSTGIFWDNDSLA
ALLSLELKADLLILLSDVEGLYTGPPSDSTSKLIHTFIKEKHQDEITFGEKSKLGRGGMT
AKVKAAVNAAYGGVPVIITSGYAAENISKVLRGLRVGTLFHQDAHLWAPVVDTTSRDMAV
AARESSRKLQALSSEDRKQILHDIANALEVNEKTIKAENDLDVAAAQEAGYEESLVARLV
MKPGKISSLAASVRQLAEMEDPIGRVLKKTQVADDLILEKTSSPIGVLLIVFESRPDALV
QIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPETVGGKLIGLVTSREEIPDLLKL
DDVIDLVIPRGSNKLVSQIKNSTKIPVLGHADGICHVYVDKSGKLDMAKRIVSDAKLDYP
AACNAMETLLVHKDLEQNGFLDDLIYVLQTKGVTLYGGPRASAKLNIPETKSFHHEYSSK
ACTVEIVEDVYGAIDHIHQHGSAHTDCIVTEDSEVAEIFLRQVDSAAVFHNASTRFSDGF
RFGLGAEVGISTSRIHARGPVGVEGLLTTRWIMRGKGQVVDGDNGIVYTHKDLPVLQRTE
AVENGI
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacggagatcgatcgttcacgcgcgttcgccaaagacgttaagcgtatcgtcgtcaag
gttgggactgcagttgttactgggaaaggtggaagattggctcttggacgtttaggagct
atctgtgaacagcttgcggagttaaactcagatggatttgaggtcattttggtgtcatct
ggtgccgttggtcttggtcgacaaaggcttcgatacagacaattagtcaacagcagtttt
gcagatttacagaagccacaaatggaacttgatgggaaggcttgtgctggtgttgggcag
agcagtctcatggcttactatgagactatgtttgaccagttggatgtgacggttgctcaa
atgcttgtgaccgatagcagttttagagataaggatttcaggaagcaacttagtgaaact
gtcaaagcgatgctgaggatgagggttattccagttttcaatgagaatgatgctataagc
actcgcagagccccctacaaggattctactggtatattttgggataatgacagcttagcc
gctcttctgtcgctagagctgaaagctgatcttttgattcttctaagtgatgttgagggc
ctttacactggccctccaagtgattctacctcaaaattaatacacacattcattaaagaa
aaacaccaggacgagattacttttggcgaaaagtccaaattaggacgagggggtatgact
gcaaaagttaaagctgctgttaatgcagcttatggtggcgttcctgttatcataaccagt
ggatatgcagctgagaatataagtaaagtccttagaggactgcgtgttggtaccctgttc
catcaagatgctcatttatgggctccggtcgtagatactacttctcgtgacatggcagtt
gctgcaagggaaagctcaagaaagcttcaggccttatcttcagaagataggaaacaaatt
ctacacgacattgccaatgcccttgaagtaaatgagaaaacaattaaagctgagaatgat
ttagatgttgctgcagcacaagaagctggatatgaagagtctttggtagctcgcttagtt
atgaagcctgggaagatctcaagccttgcagcttccgttcgccagctagccgaaatggaa
gatccaataggccgtgtattaaagaaaactcaggttgcagatgatcttattttagagaag
acctcatcaccaataggtgttcttctgattgtttttgaatcccggcctgatgcacttgtt
cagatagcttcgcttgcaatccggagtggaaatggtcttctgctgaagggtggaaaggag
gctcgtcgatcaaatgctatcttacacaaggtgatcactgatgcaattccggagactgtt
ggaggtaaactcataggacttgtgacctcaagagaggagattcctgatttgctcaagctt
gatgacgttattgatcttgtgatcccaagaggcagcaacaagcttgtttctcaaataaaa
aactcgacgaaaatcccagtgctaggccatgctgatggaatctgtcatgtatatgttgat
aagtctggtaaactggacatggcaaagcgcattgtttccgatgcaaagttggactatcca
gcagcctgtaatgcgatggaaacccttcttgtacataaagatttggagcagaatggtttt
ctcgatgatcttatttatgttctgcaaaccaaaggcgtcactttgtatggtgggccaaga
gcaagtgcaaaactgaatattccggaaacaaaatcatttcaccacgagtacagttccaag
gcctgcaccgttgaaattgtagaagacgtatatggtgctatagatcatattcaccaacat
ggaagtgcacacactgattgcatagtgacggaagatagtgaagtagcagaaatattcctc
cgccaagtggacagtgctgctgttttccacaatgcaagcacaagattctctgatggtttt
aggttcggacttggtgctgaggtgggaataagcacaagcaggattcatgcccgtggtcca
gttggagttgaaggattattgacaacaagatggataatgagaggaaagggacaagttgtg
gatggagacaatggaatcgtttacacccataaggatcttcctgtcttacaaaggacagag
gctgttgagaatggaatttag

DBGET integrated database retrieval system