KEGG   Arabidopsis thaliana (thale cress): AT3G55800Help
Entry
AT3G55800         CDS       T00041                                 

Gene name
SBPASE
Definition
(RefSeq) sedoheptulose-bisphosphatase
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Module
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT3G55800 (SBPASE)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     AT3G55800 (SBPASE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 824746
NCBI-ProteinID: NP_191139
MIPS: AT3G55800.1
TAIR: AT3G55800
Araport: AT3G55800
UniProt: P46283
Position
3
AA seq 393 aa AA seqDB search
METSIACYSRGILPPSVSSQRSSTLVSPPSYSTSSSFKRLKSSSIFGDSLRLAPKSQLKA
TKAKSNGASTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA
CVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDPLD
GSSIVDTNFTVGTIFGVWPGDKLTGITGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEFLL
LDEGKWQHVKETTEIAEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDVN
QIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGHKSVLDKTIINLDDR
TQVAYGSKNEIIRFEETLYGTSRLKNVPIGVTA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcatcgcgtgctactcacgtgggatccttcccccaagtgtctcttctcaa
cgatcctctacattggtctctcctccttcctactccacatcctccagcttcaagcgtcta
aaatcgagctcaatcttcggagattcactacgattagcaccaaaatcgcaacttaaagcc
acaaaagctaagagcaatggtgcttcaactgtgaccaaatgtgaaattggccaaagcttg
gaagagtttttggcacaagcaactcctgacaagggattgagaactttgctgatgtgtatg
ggagaagcattgagaacaatagcttttaaagttagaacagcttcttgcggtggaacagct
tgtgttaattcctttggtgatgaacaactcgctgttgatatgcttgctgataagcttctc
tttgaggctttgcaatactcgcatgtgtgcaagtatgcttgctctgaagaagtacctgag
cttcaagacatgggaggtccagtggaaggtgggtttagtgttgcgtttgatccattggat
ggatcaagcattgtggatacaaatttcactgtgggaaccatattcggtgtttggcctgga
gacaagttaaccggaatcactggaggagatcaagtggctgcagccatgggaatctacggt
ccacgaaccacttatgttttggctgttaagggctttccaggaactcatgagttcttgctt
cttgatgaagggaaatggcagcatgtaaaggagacaacagagatcgcagaagggaaaatg
ttctcaccaggaaacttaagagccacattcgacaactccgaatacagcaagctgattgat
tactacgtgaaagagaaatacacactgcgatacaccggaggaatggttcctgatgttaac
cagattattgtgaaggagaaaggaatcttcacaaatgtgacttctcctacggctaaggca
aagttgaggctgttgtttgaagtggctcctcttggcctgctcatagagaatgctggtgga
ttcagcagtgatggacacaagtccgtgcttgacaagaccatcatcaacctcgacgataga
actcaagttgcttatggctcaaagaacgagatcatccgcttcgaagaaaccctttatgga
acatcaagactcaagaatgttcccattggagttaccgcttag

DBGET integrated database retrieval system