KEGG   Arabidopsis thaliana (thale cress): AT3G55980Help
Entry
AT3G55980         CDS       T00041                                 

Gene name
SZF1
Definition
(RefSeq) salt-inducible zinc finger 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 580 aa AA seqDB search
MCSGPKSNLCSSRTLTEIESRQKEEETMLLLEFAACDDLDSFKREVEEKGLDLDESGLWY
CRRVGSKKMGLEERTPLMVAAMYGSIKVLTFIVSTGKSDVNRACGEERVTPLHCAVAGCS
VNMIEVINVLLDASALVNSVDANGNQPLDVFVRVSRFVASPRRKAVELLLRGGGVGGLID
EAVEEEIKIVSKYPADASLPDINEGVYGSDEFRMYSFKVKPCSRAYSHDWTECAFVHPGE
NARRRDPRKYPYTCVPCPEFRKGSCPKGDSCEYAHGVFESWLHPAQYKTRLCKDETGCAR
KVCFFAHKREEMRPVNASTGSAVAQSPFSSLEMMPGLSPLAYSSGVSTPPVSPMANGVPS
SPRNGGSWQNRVNTLTPPALQLNGGSRLKSTLSARDIDMEMEMELRLRGFGNNVEETFGS
YVSSPSRNSQMGQNMNQHYPSSPVRQPPSQHGFESSAAAAVAVMKARSTAFAKRSLSFKP
ATQAAPQSNLSDWGSPNGKLEWGMKGEELNKMRRSVSFGIHGNNNNNAARDYRDEPDVSW
VNSLVKDSTVVSERSFGMNERVRIMSWAEQMYREKEQTVV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagtggaccaaagagcaatctctgctcttcaagaaccttaacagaaatcgaatca
aggcaaaaggaagaagaaacaatgcttctcctcgaattcgctgcttgtgatgatcttgac
tcgttcaagagagaggttgaagagaaagggcttgatttggatgagtcagggttatggtat
tgcagacgtgtcggttctaagaagatgggtcttgaagaaagaacacctttaatggttgca
gctatgtatggaagcataaaggttttgactttcatcgtttccactggaaaatctgatgtg
aacagagcttgtggtgaagagagagttactccgcttcactgtgctgttgctggctgttct
gtgaatatgattgaagtcatcaatgtcttgcttgatgcttctgctttggttaactctgtt
gatgctaatgggaatcaacctttggatgtgtttgttcgagtttcgaggtttgtggctagt
ccgaggaggaaagcggttgagttgttgctgagaggaggaggtgttggaggattgatcgat
gaggcggttgaagaagagatcaagattgtctctaagtatccagctgatgcttctttaccg
gatataaacgaaggggtttatggaagtgatgagtttaggatgtatagctttaaggttaag
ccatgttctagggcttattctcatgattggaccgagtgtgcttttgttcatccgggagaa
aatgcgaggaggagagatccgaggaagtatccttacacttgtgtcccctgtcccgagttc
cgtaaaggatcatgcccgaaaggagattcttgcgagtatgctcacggggttttcgagtcg
tggcttcaccccgcgcagtataaaacccggctttgtaaagatgaaacgggttgtgcaagg
aaagtttgtttctttgctcataaacgcgaagagatgagacctgttaatgcttcaactggc
tctgccgtggctcagtctccgtttagcagcttggagatgatgccagggttgtctcctctt
gcttattcttcaggagtttcgactcctccggtttctccaatggctaatggtgttccttcc
tctccaagaaacggcggatcatggcagaacagagtcaatacccttactccaccggctttg
cagctcaatggtggaagcagattgaagtccacactgagcgctagagatatcgatatggag
atggagatggaattgagactccgcggttttggcaacaatgtggaagagacgttcgggtct
tatgtttcctctccaagtaggaattctcaaatgggtcaaaacatgaaccaacattatcca
tcttccccggtgagacaaccgccatctcaacacgggttcgaatcttcagcagctgcagcg
gttgcagtgatgaaagcgagatcaaccgcctttgcgaaacgtagcttgagcttcaaacca
gctactcaagcagcaccacagtcgaatctctcggattggggatctccaaacgggaagctg
gaatggggaatgaaaggagaagagctgaataagatgagaagaagtgtttcctttggaatc
catggaaacaacaacaataacgcagctagagactacagggacgagccagatgtgtcatgg
gttaactctttagttaaagacagtactgtggtgtctgagagaagctttggaatgaatgag
agggttcggataatgtcgtgggctgagcaaatgtacagagagaaggagcagactgtggtg
taa

DBGET integrated database retrieval system