KEGG   Arabidopsis thaliana (thale cress): AT3G56310Help
Entry
AT3G56310         CDS       T00041                                 

Definition
melibiase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT3G56310
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT3G56310
   00600 Sphingolipid metabolism
    AT3G56310
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AT3G56310
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AT3G56310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 437 aa AA seqDB search
MVIMKKMKDSVLFLVVGLFSLSVLVSQSIAGRVKAPLLQSNTGGLVFSKSFNSIYDTSMY
GRLQLNNGLARTPQMGWNSWNFFACNINETVIKETADALVSSGLADLGYIHVNIDDCWSN
LLRDSEGQLVPHPETFPSGIKLLADYVHSKGLKLGIYSDAGVFTCEVHPGSLFHEVDDAD
IFASWGVDYLKYDNCFNLGIKPIERYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVG
NSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIW
ALMKAPLLIGCDVRNMTAETLEILSNKEIIAVNQDPLGVQGRKIQANGENDCQQVWSGPL
SGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDVTENTSGSFEAQVDAH
DCHMYVLTPQTVSHSDV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtgattatgaagaagatgaaagattcagtcttgttcctcgtcgtaggcctcttctct
ttatctgttttggtctctcagtcgatcgcagggagagtcaaagctccattgttgcagagc
aatactggtggattagttttcagcaaatccttcaattcgatctatgatacttctatgtac
ggacgcttgcagctcaacaatggccttgctcgaactccacaaatgggatggaatagctgg
aatttctttgcttgcaatatcaatgaaactgtcataaaggaaactgctgatgctttggtt
tcatctggcctggctgatttaggatacatacatgtcaatattgatgattgctggtccaat
ttgttacgcgattcagagggtcaattggttcctcatcctgaaaccttcccatcaggaatt
aagcttcttgctgattatgttcattcaaagggtctcaaactcggtatatattctgatgct
ggcgttttcacttgtgaagttcatccgggatcccttttccatgaagtggatgatgcagac
atttttgcttcttggggcgtggattatctgaaatatgacaattgtttcaacctgggaata
aaaccaatcgaaagataccctccaatgcgtgatgctctaaacgcaactggccgctcaatc
ttctattcactatgtgaatggggcgttgatgatcctgccttgtgggcaaaagaagttgga
aacagttggcgcacaaccgatgacatcaacgatacatgggcaagtatgactacaattgct
gatttgaataacaagtgggctgcatatgctggacctggtggttggaatgatccggatatg
ttggaaatagggaatggagggatgacatacgaggagtatcgaggtcattttagcatttgg
gctttgatgaaggcacctctcttgattggttgtgatgtaagaaacatgaccgctgaaact
ttggagattttgagtaataaggagattatcgctgttaaccaagacccacttggtgttcaa
ggaaggaaaattcaagccaatggagaaaatgattgtcagcaggtgtggtcaggaccttta
tctggtgaccgtatggtagttgctctctggaaccgttgctctgagccagcaactattaca
gcatcatgggatatgatcggtcttgaatctaccattagcgtttcagtaagagatttgtgg
cagcacaaagatgtaacagagaatacttctggctcctttgaagctcaagttgacgcacac
gactgtcatatgtacgttctcactccccagacagtatcacactctgatgtatag

DBGET integrated database retrieval system