KEGG   Arabidopsis thaliana (thale cress): AT3G56310Help
Entry
AT3G56310         CDS       T00041                                 

Definition
(RefSeq) Melibiase family protein
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00561  Glycerolipid metabolism
ath00600  Sphingolipid metabolism
ath00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT3G56310
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT3G56310
   00600 Sphingolipid metabolism
    AT3G56310
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AT3G56310
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AT3G56310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 824798
NCBI-ProteinID: NP_191190
MIPS: AT3G56310.1
TAIR: AT3G56310
Araport: AT3G56310
UniProt: Q8VXZ7
Position
3
AA seq 437 aa AA seqDB search
MVIMKKMKDSVLFLVVGLFSLSVLVSQSIAGRVKAPLLQSNTGGLVFSKSFNSIYDTSMY
GRLQLNNGLARTPQMGWNSWNFFACNINETVIKETADALVSSGLADLGYIHVNIDDCWSN
LLRDSEGQLVPHPETFPSGIKLLADYVHSKGLKLGIYSDAGVFTCEVHPGSLFHEVDDAD
IFASWGVDYLKYDNCFNLGIKPIERYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVG
NSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIW
ALMKAPLLIGCDVRNMTAETLEILSNKEIIAVNQDPLGVQGRKIQANGENDCQQVWSGPL
SGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDVTENTSGSFEAQVDAH
DCHMYVLTPQTVSHSDV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtgattatgaagaagatgaaagattcagtcttgttcctcgtcgtaggcctcttctct
ttatctgttttggtctctcagtcgatcgcagggagagtcaaagctccattgttgcagagc
aatactggtggattagttttcagcaaatccttcaattcgatctatgatacttctatgtac
ggacgcttgcagctcaacaatggccttgctcgaactccacaaatgggatggaatagctgg
aatttctttgcttgcaatatcaatgaaactgtcataaaggaaactgctgatgctttggtt
tcatctggcctggctgatttaggatacatacatgtcaatattgatgattgctggtccaat
ttgttacgcgattcagagggtcaattggttcctcatcctgaaaccttcccatcaggaatt
aagcttcttgctgattatgttcattcaaagggtctcaaactcggtatatattctgatgct
ggcgttttcacttgtgaagttcatccgggatcccttttccatgaagtggatgatgcagac
atttttgcttcttggggcgtggattatctgaaatatgacaattgtttcaacctgggaata
aaaccaatcgaaagataccctccaatgcgtgatgctctaaacgcaactggccgctcaatc
ttctattcactatgtgaatggggcgttgatgatcctgccttgtgggcaaaagaagttgga
aacagttggcgcacaaccgatgacatcaacgatacatgggcaagtatgactacaattgct
gatttgaataacaagtgggctgcatatgctggacctggtggttggaatgatccggatatg
ttggaaatagggaatggagggatgacatacgaggagtatcgaggtcattttagcatttgg
gctttgatgaaggcacctctcttgattggttgtgatgtaagaaacatgaccgctgaaact
ttggagattttgagtaataaggagattatcgctgttaaccaagacccacttggtgttcaa
ggaaggaaaattcaagccaatggagaaaatgattgtcagcaggtgtggtcaggaccttta
tctggtgaccgtatggtagttgctctctggaaccgttgctctgagccagcaactattaca
gcatcatgggatatgatcggtcttgaatctaccattagcgtttcagtaagagatttgtgg
cagcacaaagatgtaacagagaatacttctggctcctttgaagctcaagttgacgcacac
gactgtcatatgtacgttctcactccccagacagtatcacactctgatgtatag

DBGET integrated database retrieval system