KEGG   Arabidopsis thaliana (thale cress): AT3G56850Help
Entry
AT3G56850         CDS       T00041                                 

Gene name
AREB3
Definition
(RefSeq) ABA-responsive element binding protein 3
  KO
K14432  
ABA responsive element binding factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT3G56850 (AREB3)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AREB/ABF
    AT3G56850 (AREB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 297 aa AA seqDB search
MDSQRGIVEQAKSQSLNRQSSLYSLTLDEVQNHLGSSGKALGSMNLDELLKSVCSVEANQ
PSSMAVNGGAAAQEGLSRQGSLTLPRDLSKKTVDEVWKDIQQNKNGGSAHERRDKQPTLG
EMTLEDLLLKAGVVTETIPGSNHDGPVGGGSAGSGAGLGQNITQVGPWIQYHQLPSMPQP
QAFMPYPVSDMQAMVSQSSLMGGLSDTQTPGRKRVASGEVVEKTVERRQKRMIKNRESAA
RSRARKQAYTHELEIKVSRLEEENERLRKQKEVEKILPSVPPPDPKRQLRRTSSAPF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggattctcagaggggtattgttgaacaagctaaatctcagtccttgaataggcaaagc
tctctttacagcttaacacttgatgaggttcaaaatcacttggggagttctggtaaagct
ctgggaagcatgaaccttgatgagcttttgaagagtgtctgttctgttgaagctaatcag
ccatcgtctatggctgtcaatggtggagcagctgctcaggagggtctttctcgccagggg
agtttgactttgcctcgggatctcagcaaaaagactgttgatgaggtttggaaagacatt
cagcagaataagaatggaggtagtgctcatgagaggagggataagcagcctacacttggg
gaaatgacgcttgaagacctgttgttgaaagcaggagtggtcactgagactatccctggt
tcgaaccatgatggtcctgttggtggtggtagtgctggttcaggtgctggtttagggcaa
aacattactcaagttggcccatggattcaatatcatcagctcccatcaatgccacagcct
caagcatttatgccctatccggtttcagatatgcaagcaatggtgtctcagtcttctttg
atgggtggtttgtcagatacacaaactcctggaaggaagagggtagcttcaggagaagtt
gtagagaagactgtagagaggaggcagaagagaatgataaagaacagagagtctgctgct
cgttcccgagctaggaaacaggcttacactcatgagctagagatcaaagtttcacggtta
gaagaagaaaacgaaagactcaggaagcaaaaggaggtggaaaaaatcctcccaagtgta
ccaccgcctgatcccaagcggcagctccgacggacaagctcggctcctttctga

DBGET integrated database retrieval system