KEGG   Arabidopsis thaliana (thale cress): AT3G57040Help
Entry
AT3G57040         CDS       T00041                                 

Gene name
ARR9
Definition
(RefSeq) response regulator 9
  KO
K14492  two-component response regulator ARR-A family
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT3G57040 (ARR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-GeneID: 824871
NCBI-ProteinID: NP_001325622
MIPS: AT3G57040.1
TAIR: AT3G57040
Araport: AT3G57040
UniProt: O80366
Position
3
AA seq 234 aa AA seqDB search
MGMAAESQFHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQSTDSNDPN
AFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISR
CLEEGAEEFFLKPVRLADLNKLKPHMMKTKLKNQKLEEIETTSKVENGVPTAVADPEIKD
STNIEIEILPLQQDLLLVQQEEQTLSINNKRKSVEEGISTDRARPRFDGIATAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggtatggcagcagaatcgcagtttcatgttttagctgttgatgatagtttatttgat
cggaaacttattgagagattgcttcaaaagtcttcgtgtcaagtaacaactgttgattct
ggctcaaaggctttggagtttctgggtttaagacaaagtactgatagtaacgacccaaat
gcgttttctaaggctcctgttaatcaccaggtagttgaagtgaatcttataattacagat
tattgtatgcctggcatgactggttatgatttgctcaagaaagtcaaggaatcatcagct
tttagagatataccagtagttatcatgtcctcagagaacgttcctgcaagaatcagcaga
tgtttagaagaaggagctgaagagtttttcttgaaaccagtaagattggctgatcttaac
aagttgaaacctcatatgatgaaaacaaagttgaagaaccagaagctggaggagattgag
acaacttcaaaagtcgaaaatggagtccccactgcagtagctgatccagagattaaagat
tcaacaaacattgaaattgaaatcttgcctctgcaacaagatctgctattagttcaacaa
gaggagcaaacattgagtatcaacaacaagaggaagtcagtggaagaagggatttcaact
gatagagcacgtcctagattcgacggtatcgcaaccgctgtctga

DBGET integrated database retrieval system