KEGG   Arabidopsis thaliana (thale cress): AT3G57130Help
Entry
AT3G57130         CDS       T00041                                 

Gene name
BOP1
Definition
(RefSeq) Ankyrin repeat family protein / BTB/POZ domain-containing protein
  KO
K14508  
regulatory protein NPR1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT3G57130 (BOP1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     AT3G57130 (BOP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 467 aa AA seqDB search
MSNTFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESD
PSQPGAEPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEPRSNC
GDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASR
KQDMHQLWTTCSYLIAKSGLPQEILAKHLPIELVAKIEELRLKSSMPLRSLMPHHHDLTS
TLDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREVVKALLELG
AADVNYPAGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILRTLTSDFL
FKGAIPGLTHIEPNKLRLCLELVQSAALVISREEGNNNSNDNNTMIYPRMKDEHTSGSSL
DSRLVYLNLGATNRDIGDDNSNQREGMNLHHHHHDPSTMYHHHHHHF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatactttcgaagaatcactcaaatctatgtcattggattacctaaacctctta
atcaacggtcaagctttctccgatgtcactttcagcgtcgaaggccgtctagtccacgct
caccgttgcatcctcgctgctcgtagcctcttcttccgcaaattcttctgtgaatctgat
ccttcgcaacccggagctgaacccgctaaccaaaccggatcaggagccagagcagccgca
gtaggaggagtcataccggttaactcagtcggttacgaagttttcttacttctacttcaa
ttcttgtacagtggtcaagtctcaattgtaccacataagcacgagccaagatcgaattgt
ggagatagaggatgctggcacacgcattgcactgcagccgtcgatctctctttagatatt
ttagccgccgctcgctactttggcgtcgagcagctcgcgttgcttactcagaaacatttg
acaagtatggtggagaaagcctccattgaagatgtgatgaaagtgctcatagcttcaaga
aagcaagacatgcatcaattatggactacttgctcttacttaatcgccaaatccggtctt
ccacaagagattctagccaaacatctcccaatcgaacttgtagccaagattgaggagctc
cgtctcaaatcttcaatgcctctccgttcactaatgcctcaccaccatgacctaacctcg
actttagacctcgaagaccagaagatcaggaggatgagacgtgcattggactcctctgat
gtcgagcttgtgaagctaatggtgatgggagaaggactcaatctagatgagtccctagct
ttgatttacgcggttgaaaattgtagtagagaggttgtaaaggcacttcttgagcttgga
gcagctgatgtgaactatcccgcgggtcccacagggaaaaccgctcttcacattgcggct
gaaatggtgtctccggacatggtggctgttttactcgaccaccacgccgaccctaacgtc
cagacagtggatggaatcactcctctcgacatccttcgaaccctaacgtcagattttttg
ttcaagggggcaattcctggattgactcacattgagcccaataagcttaggctttgtctc
gagctggtccagtccgcggcattggttatatcacgcgaagaaggaaacaataacagtaac
gataacaacacaatgatctaccctaggatgaaagacgaacacacgagcggaagtagtttg
gattcaagattggtttatctgaatcttggtgctacaaatcgtgatattggagatgacaat
agcaatcaaagggaaggaatgaatctgcatcatcatcatcatgacccatcaacgatgtat
catcaccaccaccaccatttctag

DBGET integrated database retrieval system