KEGG   Arabidopsis thaliana (thale cress): AT3G57550Help
Entry
AT3G57550         CDS       T00041                                 

Gene name
AGK2
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AT3G57550 (AGK2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AT3G57550 (AGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 390 aa AA seqDB search
MGEAPAFFVDHLENGYTNGFGVKSEPKNRDTSVLIGDRSFVIGGNHEGNPLFLGVQIHDK
VTNKWSSPSVLGTGPKPCKGYSAIVLPKGRILVIKKGSASDDSIWFLEVDTPFIREQKKL
LGREVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRAPRCME
KNGVHYHFTDKTVMEKEIKDGKFLEFASVHGNLYGTSIESVEVVTDSGKRCILDIDVQGA
RSVKASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNADAEIKAGKSSGIFEH
KLYNDNLEECYKTLKNLLGINDLAPVNGVEAVEGINLPKEHTVTKMDDKILIQETGEGTK
NKMIVLDLSSINGGAPGRTRGIVLDTVKSS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagcaccagctttctttgtggatcatctggagaatggatacaccaatggcttt
ggtgtcaaatccgagcctaagaacagagatacatctgtgcttattggggatcgatccttt
gtgattggtggaaatcatgaaggaaacccattgttccttggtgttcagattcatgacaaa
gtcactaacaagtggtccagtcctagtgttcttggaactggccctaaaccctgcaagggt
tactctgccattgttcttccaaaaggtcggattttggttatcaaaaaaggctcagcttct
gatgactccatttggttccttgaggtggatactccttttatccgggaacaaaagaaattg
cttggaagagaggttgttgcttggagtaaaggagtaaggggaaatgcagagaagcctatt
gttataagcggtccttctggagttggaaaaggaacacttatatcgatgctcatgaaggag
tttccttcaatgtttgggttctctgtgagccacacgactcgagctccaaggtgtatggag
aagaatggtgttcactaccatttcactgataagactgttatggagaaagaaatcaaagat
gggaagtttctcgagtttgcgtctgttcacggcaatctatacggaaccagcattgaatcc
gttgaggttgtaacagattcaggaaagagatgcattttggatattgatgttcaaggagcg
aggtcagtgaaggcgagttcactggatgcgatattcatattcgtttgtcctccttcaatg
aaggaacttgaagatcggcttcgtgcccgaggaacagagacagaggagcaaatccaaaag
cggcttagaaacgctgacgcagagatcaaagcagggaaatcctctggcatttttgaacac
aaactgtataatgacaaccttgaggaatgctacaagacccttaagaatctcttggggatt
aacgaccttgctcctgtgaatggtgtagaagcagtagaagggatcaatctgcccaaggag
cacacagtaacaaagatggatgacaagattttgattcaagaaacaggagaaggaaccaag
aacaaaatgatcgtgttggatttatcttcaatcaacgggggagcaccgggaagaacaaga
gggatcgttctggacacggttaagtccagttga

DBGET integrated database retrieval system