KEGG   Arabidopsis thaliana (thale cress): AT3G59960Help
Entry
AT3G59960         CDS       T00041                                 

Gene name
ASHH4
Definition
histone-lysine N-methyltransferase ASHH4
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AT3G59960 (ASHH4)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT3G59960 (ASHH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 352 aa AA seqDB search
MSSSKKGSDRNQIRKSLRKLKKQIGELEKLESPDRLNNVKPIFIKRNIYLKKKLKKKVKD
HGIFCSCSLDPGSSTLCGSDCNCGILLSSCSSSCKCSSECTNKPFQQRHIKKMKLVQTEK
CGYGIVADEDINSGEFIIEYVGEVIDDKICEERLWKLNHKVETNFYLCQINWNMVIDATH
KGNKSRYINHSCSPNTEMQKWIIDGETRIGIFATRFINKGEQLTYDYQFVQFGADQDCYC
GAVCCRKKLGAKPCKTKNTTLEEAVKPVACKVTWKTPKLLNSEVRETNLDASGQAWNNHS
QRKICCRDCIGAYYTAQMKVLTLVVDIFQVMYEDGVTEIIDMCREVWKVVTA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcgaagaagggttccgatcggaatcaaatcaggaagtcgttgaggaagtta
aaaaagcagattggggaattggagaaacttgaatctccggatcggttgaataatgtgaag
cctatcttcatcaagcgcaatatatacttgaagaagaaactcaagaagaaagttaaggat
catggcatattctgttcttgctccttggatcctggttcttcaactctttgtggcagcgat
tgcaattgtgggattctactctcaagctgttcgtctagttgcaaatgcagtagtgaatgc
accaacaagccgttccaacaacgacatatcaagaagatgaagttagttcagacagagaaa
tgtggatatgggattgtagcagatgaagatatcaactcaggagagtttatcattgaatat
gtgggagaagttattgacgacaagatttgtgaagaaaggctttggaagctgaatcataag
gtcgagacaaatttctatttgtgtcagataaactggaacatggtgattgatgctactcac
aagggtaataaatcaagatacatcaatcacagctgcagtcctaacacagagatgcagaaa
tggataattgatggcgagacaagaatcggcatttttgctacccgtttcataaacaaaggc
gagcagttgacttacgattaccagtttgttcagtttggtgcagatcaagattgctactgt
ggtgcagtgtgttgcagaaaaaagctaggtgcaaaaccttgcaaaactaagaacacaacc
ttagaagaagctgtgaagccagtggcatgtaaagtgacctggaaaacgcccaagcttctc
aattcagaggtaagagaaaccaatttggatgcgtcaggacaagcttggaacaatcatagc
cagaggaaaatatgttgccgggactgcattggtgcgtattacacggctcagatgaaggtt
ttgactctagtagttgacatttttcaggtcatgtatgaggatggtgttaccgagatcatc
gacatgtgcagagaagtttggaaggttgtaactgcttga

DBGET integrated database retrieval system