KEGG   Arabidopsis thaliana (thale cress): AT3G60010Help
Entry
AT3G60010         CDS       T00041                                 

Gene name
SK13
Definition
(RefSeq) SKP1-like 13
  KO
K03094  S-phase kinase-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
ath04141  Protein processing in endoplasmic reticulum
Module
ath_M00381  SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT3G60010 (SK13)
   04120 Ubiquitin mediated proteolysis
    AT3G60010 (SK13)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     AT3G60010 (SK13)
   Cul7 complex
     AT3G60010 (SK13)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     AT3G60010 (SK13)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     AT3G60010 (SK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1 Skp1_POZ Methyltrans_RNA
Motif
Other DBs
NCBI-GeneID: 825171
NCBI-ProteinID: NP_567090
MIPS: AT3G60010.1
TAIR: AT3G60010
Araport: AT3G60010
UniProt: Q9M1X5 A0A178VIM9
Position
3
AA seq 154 aa AA seqDB search
MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKK
HVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMIT
GKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatggttatgttgctgagctccgatggtgaatctttccaggtcgaagaagca
gtcgcggtccagtcacagacgatagcacatatgattgaagacgattgcgtcgccaatgga
gtccctatcgcaaacgttacaggagtcatcctctcgaaggtgatcgagtattgcaagaaa
cacgtcgtttctgattcaccaaccgaagagagcaaagacgaactcaagaagtgggacgct
gagttcatgaaggccctggaacagtcgtcgactctctttgatgttatgctggctgcgaat
tacctaaacataaaagacctgcttgaccttggttgccaaactgttgctgacatgatcact
ggcaagaaaccagacgagattcgtgcacttcttggcatcgagaacgattttacaccggag
gaggaagaggagattcgtaaggagaatcaatgggcttttgaatga

DBGET integrated database retrieval system