KEGG   Arabidopsis thaliana (thale cress): AT3G60820Help
Entry
AT3G60820         CDS       T00041                                 

Gene name
PBF1
Definition
(RefSeq) N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein
  KO
K02732  
20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Proteasome
Module
Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    AT3G60820 (PBF1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     AT3G60820 (PBF1)
Peptidases [BR:ath01002]
 Threonine Peptidases
  Family T1: proteasome family
   AT3G60820 (PBF1)
Proteasome [BR:ath03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    AT3G60820 (PBF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
3
AA seq 223 aa AA seqDB search
MTKQHANWSPYDNNGGTCVAIAGSDYCVIAADTRMSTGYSILSRDYSKIHKLADRAVLSS
SGFQADVKALQKVLKSRHLIYQHQHNKQMSCPAMAQLLSNTLYFKRFFPYYAFNVLGGLD
EEGKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAE
AVDLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacagcacgcgaactggtctccttacgataacaatggaggaacatgtgtggcc
atcgctggatcggattactgtgttatcgccgccgatactcggatgtctactggttacagt
attcttagtcgcgattactccaaaatccataaactagcggacagagctgttttgtcttcc
tctggcttccaggctgatgtgaaagctttgcagaaggttctcaaatccagacacttgatc
tatcaacatcagcataacaagcagatgagctgtcctgcaatggcccagcttctctccaac
acgctttatttcaagcggtttttcccctactatgcctttaatgttctaggagggcttgac
gaggaaggaaaagggtgtgtctttacttacgacgctgttggctcatacgagagagttgga
tacggtgctcaaggttctggttccacactcatcatgcctttccttgacaatcagctcaag
tctccaagtcctcttttgctacctaaacaggattcaaacacgcccctttccgaagctgaa
gcagttgacttggttaaaactgttttcgcatctgccacagagagggatatctacactgga
gacaagcttgagattatgatacttaaggccgacggtatcaagaccgaactcatggacctg
aggaaagactaa

DBGET integrated database retrieval system