KEGG   Arabidopsis thaliana (thale cress): AT3G61610Help
Entry
AT3G61610         CDS       T00041                                 

Definition
galactose mutarotase-like superfamily protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G61610
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AT3G61610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 317 aa AA seqDB search
MGQYATVWDQKEASEIIKDWNGVDQVLLRNPHGASAKISLHGGQVISWRNELGEELLFTS
NKAIFKPPKSMRGGIQICYPQFGDCGSLDQHGFARNKIWVIDENPPPLNSNESLGKSFVD
LLLKPSEDDLKQWPHSFEFRLRVSLAVDGDLTLTSRIRNINGKPFSFSFAYHTYLSVSDI
SEVRIEGLETLDYLDNLSQRQLLTEQGDAITFESEMDRTYLRSPKVVAVLDHERKRTYVI
GKEGLPDTVVWNPWEKKSKTMADFGDEEYKSMLCVDGAAVERPITLKPGEEWTGRLILTA
VKSSFCFDQLELQSKGF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaatatgcaacagtgtgggatcaaaaagaagcaagtgagataatcaaagattgg
aatggcgttgaccaagtccttctcagaaacccacatggtgcttctgccaagataagttta
catggaggacaagtgatttcatggaggaatgaactaggcgaagagcttcttttcactagc
aataaggctatattcaaacccccaaaatcaatgcgtggagggattcagatttgttatccg
cagtttggggattgtggatcactggatcaacatgggtttgcaaggaacaaaatttgggta
atcgatgagaacccacctccacttaactcaaacgaatccttaggaaaatcctttgttgat
cttcttttgaaaccatcagaagatgacttaaagcaatggcctcatagtttcgagttccgt
cttagggtttcgcttgctgtagatggcgacttaacattgacttctcggattagaaacatc
aatggcaagccttttagcttctcatttgcatatcacacctacctctctgtctctgacata
agtgaagtgagaattgaagggttggagacattggactacttagacaacctcagccaaaga
cagcttttgactgaacaaggcgatgcaataacctttgaatccgagatggaccggacatac
cttagatcaccaaaggtggttgcagttcttgatcatgaacggaaaagaacatatgttatc
ggaaaggaaggacttccagacaccgtggtgtggaatccatgggagaagaaatcgaaaaca
atggcggattttggtgatgaagagtacaaaagcatgctttgtgtggatggtgcagcagtg
gagagaccgatcactttgaagccaggagaagaatggaccggccggctaatattgaccgct
gttaaatccagtttctgcttcgatcaactcgaactacagagcaagggattctga

DBGET integrated database retrieval system