KEGG   Arabidopsis thaliana (thale cress): AT3G62030Help
Entry
AT3G62030         CDS       T00041                                 

Gene name
ROC4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP20-3
  KO
K03768  
peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AT3G62030 (ROC4)
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AT3G62030 (ROC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 260 aa AA seqDB search
MASSSSMQMVHTSRSIAQIGFGVKSQLVSANRTTQSVCFGARSSGIALSSRLHYASPIKQ
FSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDVEIGGEVAGRIVMGLFGEVV
PKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFT
LKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRA
FDVPKKGCRIYACGELPLDA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgtcttctatgcagatggttcacacttcccgctccattgcccagattggg
ttcggtgttaagtcgcaattagtttctgcaaatcgaacaactcaatcagtttgctttgga
gctcgttcctctggaattgcattatcttcgagattgcactatgcatcacccattaagcaa
ttttctggggtttatgcgaccaccaagcatcagagaaccgcttgtgttaaatccatggct
gctgaggaagaagaagtaatcgaacctcaagctaaagtgacaaacaaggtttactttgat
gtggaaattggaggtgaagttgctggcagaattgtgatgggtctctttggagaagttgtg
cctaaaaccgttgaaaacttccgtgccttgtgtactggtgagaagaaatacgggtacaag
ggttcctctttccatcgtattattaaggatttcatgatccaaggaggtgatttcaccgag
ggaaatggtactggaggtattagtatttacggtgccaagttcgaagatgaaaacttcacc
ctgaagcatactggacctggaatcttgagcatggcaaacgctggtcctaatactaatgga
agccagtttttcatttgtaccgtcaagacttcatggttagataacaagcatgtcgtgttt
ggacaagtaattgaaggtatgaagcttgttaggactcttgagtctcaagagactcgcgct
ttcgatgttcccaagaaaggttgtagaatctatgcctgcggagagctcccgttagatgct
tga

DBGET integrated database retrieval system