KEGG   Arabidopsis thaliana (thale cress): AT3G62410Help
Entry
AT3G62410         CDS       T00041                                 

Gene name
CP12-2
Definition
(RefSeq) calvin cycle protein CP12-2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 131 aa AA seqDB search
MATIATGLNIATQRVFVTSENRPVCLAGPVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGI
SDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDPLEEYCKDN
PETNECRTYDN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcaactatagctactggtcttaacattgcaacccagcgtgtcttcgtcaccagcgag
aatcggccagtttgtctcgccggtccggtccatttgaacaattcgtggaatcttgggtca
agaacaactaaccggatgatgaaacttcagccgattaaagcagcaccggaaggagggata
tcggacgtagtggagaaaagcattaaggaagctcaggagacttgtgcgggcgatcctgtg
agtggagagtgtgtagctgcgtgggacgaggttgaagaacttagcgcagcagctagccat
gctagagacaagaagaaggctgatggttcggaccctttggaggaatactgcaaagacaat
cctgagaccaacgagtgccgtacttacgacaactga

DBGET integrated database retrieval system