KEGG   Arabidopsis thaliana (thale cress): AT4G00490Help
Entry
AT4G00490         CDS       T00041                                 

Gene name
BAM2
Definition
beta-amylase 2
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT4G00490 (BAM2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     AT4G00490 (BAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 542 aa AA seqDB search
MAIRLNHSVIPVSVKLGAPTRVSARSSLPFSVGDWRGVSTFSGARPLVLAKVKLRAESTE
EDRVPIDDDDDSTDQLVDEEIVHFEERDFAGTACVPVYVMLPLGVIDMNSEVVEPEELLD
QLRTLKSVNVDGVMVDCWWGIVESHTPQVYNWSGYKKLFQMIRELGLKIQVVMSFHECGG
NVGDDVHIQIPEWVREIGQSNPDIYFTDSAGRRNTECLTWGIDKQRVLRGRTALEVYFDY
MRSFRVEFDEFFEEKIIPEIEVGLGPCGELRYPSYPAQFGWKYPGIGEFQCYDKYLMNSL
KEAAEVRGHSFWGRGPDNTETYNSTPHGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDR
VLAMANLAFEGTCIAAKLSGIHWWYKTASHAAELTAGFYNSSNRDGYGPIAAMFKKHDAA
LNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDREGYNKIL
ENAKPLTDPDGRHLSCFTYLRLNPTLMESQNFKEFERFLKRMHGEAVPDLGLAPGTQETN
PE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaggttgaatcatagtgtaattccagtgagcgtgaagcttggagctccgacg
agagtatcggctcggagctcgttaccgttcagcgttggagattggcgtggtgtttctaca
ttttccggtgctaggcctttggttctcgcgaaggtgaaactgagagcagagagtactgag
gaagatcgagttccaattgatgacgacgacgattctactgatcagctcgttgatgaagaa
attgtgcatttcgaagagcgtgattttgctggcacagcgtgtgttcctgtatatgttatg
ctaccactgggagtgattgatatgaactcggaagtggtggaaccggaggagcttttggat
cagttaagaactttaaagtcggttaatgttgatggtgttatggttgactgctggtgggga
attgttgagtcacatacaccacaggtttataactggagtggttacaagaaactttttcag
atgattcgtgagcttggacttaagattcaggttgttatgtcgtttcacgaatgtggaggc
aatgttggagatgatgtgcatatacaaatccctgagtgggtgagagaaattggtcaaagc
aatcctgacatctacttcactgacagtgctggcaggcgtaacactgaatgccttacttgg
ggaattgacaagcaacgtgttttaagaggacggactgctcttgaggtttactttgattac
atgagaagctttcgtgtggaatttgatgaattctttgaggagaaaatcatccctgaaatt
gaagttggactaggtccatgtggggagctgaggtatccttcataccctgcacaatttggg
tggaaataccctggtattggtgaattccagtgttatgataaatatttgatgaatagctta
aaggaggctgcagaagtaagaggccacagcttttggggcagaggacctgataacacagag
acttataattcaacaccacatgggactggattttttcgcgatggaggcgattatgacagc
tactatggtagattctttcttaattggtactcaagagttctgattgaccatggtgatcgt
gttcttgctatggcaaatttggctttcgaaggaacttgcattgctgcaaagctctcaggt
atacactggtggtataaaacagctagtcatgctgctgaactcactgctggcttctacaac
tcctcaaaccgtgatggctatggtccaatagctgcaatgtttaagaaacatgatgctgct
ctcaacttcacatgtgtggagttacggacacttgatcaacatgaggatttcccagaggct
ctggcagatccagaaggtctagtttggcaggtgctgaatgctgcttgggatgctagtata
cctgttgctagtgaaaatgctcttccttgttatgacagagaaggttacaacaagatactt
gaaaacgcaaagccccttaccgatcctgatggtcgccacctttcatgtttcacttacctg
aggcttaacccaactctgatggagtctcaaaacttcaaagagtttgagagattcctcaaa
cgaatgcatggtgaagccgttccggatcttggtttggctccagggacacaagagaccaac
cccgagtga

DBGET integrated database retrieval system