KEGG   Arabidopsis thaliana (thale cress): AT4G00490Help
Entry
AT4G00490         CDS       T00041                                 

Gene name
BAM2
Definition
(RefSeq) beta-amylase 2
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT4G00490 (BAM2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     AT4G00490 (BAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14
Motif
Other DBs
NCBI-GeneID: 827959
NCBI-ProteinID: NP_191958
MIPS: AT4G00490.1
TAIR: AT4G00490
Araport: AT4G00490
UniProt: O65258
Position
4
AA seq 542 aa AA seqDB search
MAIRLNHSVIPVSVKLGAPTRVSARSSLPFSVGDWRGVSTFSGARPLVLAKVKLRAESTE
EDRVPIDDDDDSTDQLVDEEIVHFEERDFAGTACVPVYVMLPLGVIDMNSEVVEPEELLD
QLRTLKSVNVDGVMVDCWWGIVESHTPQVYNWSGYKKLFQMIRELGLKIQVVMSFHECGG
NVGDDVHIQIPEWVREIGQSNPDIYFTDSAGRRNTECLTWGIDKQRVLRGRTALEVYFDY
MRSFRVEFDEFFEEKIIPEIEVGLGPCGELRYPSYPAQFGWKYPGIGEFQCYDKYLMNSL
KEAAEVRGHSFWGRGPDNTETYNSTPHGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDR
VLAMANLAFEGTCIAAKLSGIHWWYKTASHAAELTAGFYNSSNRDGYGPIAAMFKKHDAA
LNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDREGYNKIL
ENAKPLTDPDGRHLSCFTYLRLNPTLMESQNFKEFERFLKRMHGEAVPDLGLAPGTQETN
PE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaggttgaatcatagtgtaattccagtgagcgtgaagcttggagctccgacg
agagtatcggctcggagctcgttaccgttcagcgttggagattggcgtggtgtttctaca
ttttccggtgctaggcctttggttctcgcgaaggtgaaactgagagcagagagtactgag
gaagatcgagttccaattgatgacgacgacgattctactgatcagctcgttgatgaagaa
attgtgcatttcgaagagcgtgattttgctggcacagcgtgtgttcctgtatatgttatg
ctaccactgggagtgattgatatgaactcggaagtggtggaaccggaggagcttttggat
cagttaagaactttaaagtcggttaatgttgatggtgttatggttgactgctggtgggga
attgttgagtcacatacaccacaggtttataactggagtggttacaagaaactttttcag
atgattcgtgagcttggacttaagattcaggttgttatgtcgtttcacgaatgtggaggc
aatgttggagatgatgtgcatatacaaatccctgagtgggtgagagaaattggtcaaagc
aatcctgacatctacttcactgacagtgctggcaggcgtaacactgaatgccttacttgg
ggaattgacaagcaacgtgttttaagaggacggactgctcttgaggtttactttgattac
atgagaagctttcgtgtggaatttgatgaattctttgaggagaaaatcatccctgaaatt
gaagttggactaggtccatgtggggagctgaggtatccttcataccctgcacaatttggg
tggaaataccctggtattggtgaattccagtgttatgataaatatttgatgaatagctta
aaggaggctgcagaagtaagaggccacagcttttggggcagaggacctgataacacagag
acttataattcaacaccacatgggactggattttttcgcgatggaggcgattatgacagc
tactatggtagattctttcttaattggtactcaagagttctgattgaccatggtgatcgt
gttcttgctatggcaaatttggctttcgaaggaacttgcattgctgcaaagctctcaggt
atacactggtggtataaaacagctagtcatgctgctgaactcactgctggcttctacaac
tcctcaaaccgtgatggctatggtccaatagctgcaatgtttaagaaacatgatgctgct
ctcaacttcacatgtgtggagttacggacacttgatcaacatgaggatttcccagaggct
ctggcagatccagaaggtctagtttggcaggtgctgaatgctgcttgggatgctagtata
cctgttgctagtgaaaatgctcttccttgttatgacagagaaggttacaacaagatactt
gaaaacgcaaagccccttaccgatcctgatggtcgccacctttcatgtttcacttacctg
aggcttaacccaactctgatggagtctcaaaacttcaaagagtttgagagattcctcaaa
cgaatgcatggtgaagccgttccggatcttggtttggctccagggacacaagagaccaac
cccgagtga

DBGET integrated database retrieval system