KEGG   Arabidopsis thaliana (thale cress): AT4G01690Help
Entry
AT4G01690         CDS       T00041                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT4G01690 (PPOX)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AT4G01690 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 537 aa AA seqDB search
MELSLLRPTTQSLLPSFSKPNLRLNVYKPLRLRCSVAGGPTVGSSKIEGGGGTTITTDCV
IVGGGISGLCIAQALATKHPDAAPNLIVTEAKDRVGGNIITREENGFLWEEGPNSFQPSD
PMLTMVVDSGLKDDLVLGDPTAPRFVLWNGKLRPVPSKLTDLPFFDLMSIGGKIRAGFGA
LGIRPSPPGREESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWKLEQ
NGGSIIGGTFKAIQERKNAPKAERDPRLPKPQGQTVGSFRKGLRMLPEAISARLGSKVKL
SWKLSGITKLESGGYNLTYETPDGLVSVQSKSVVMTVPSHVASGLLRPLSESAANALSKL
YYPPVAAVSISYPKEAIRTECLIDGELKGFGQLHPRTQGVETLGTIYSSSLFPNRAPPGR
ILLLNYIGGSTNTGILSKSEGELVEAVDRDLRKMLIKPNSTDPLKLGVRVWPQAIPQFLV
GHFDILDTAKSSLTSSGYEGLFLGGNYVAGVALGRCVEGAYETAIEVNNFMSRYAYK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagttatctcttctccgtccgacgactcaatcgcttcttccgtcgttttcgaagccc
aatctccgattaaatgtttataagcctcttagactccgttgttcagtggccggtggacca
accgtcggatcttcaaaaatcgaaggcggaggaggcaccaccatcacgacggattgtgtg
attgtcggcggaggtattagtggtctttgcatcgctcaggcgcttgctactaagcatcct
gatgctgctccgaatttaattgtgaccgaggctaaggatcgtgttggaggcaacattatc
actcgtgaagagaatggttttctctgggaagaaggtcccaatagttttcaaccgtctgat
cctatgctcactatggtggtagatagtggtttgaaggatgatttggtgttgggagatcct
actgcgccaaggtttgtgttgtggaatgggaaattgaggccggttccatcgaagctaaca
gacttaccgttctttgatttgatgagtattggtgggaagattagagctggttttggtgca
cttggcattcgaccgtcacctccaggtcgtgaagaatctgtggaggagtttgtacggcgt
aacctcggtgatgaggtttttgagcgcctgattgaaccgttttgttcaggtgtttatgct
ggtgatccttcaaaactgagcatgaaagcagcgtttgggaaggtttggaaactagagcaa
aatggtggaagcataataggtggtacttttaaggcaattcaggagaggaaaaacgctccc
aaggcagaacgagacccgcgcctgccaaaaccacagggccaaacagttggttctttcagg
aagggacttcgaatgttgccagaagcaatatctgcaagattaggtagcaaagttaagttg
tcttggaagctctcaggtatcactaagctggagagcggaggatacaacttaacatatgag
actccagatggtttagtttccgtgcagagcaaaagtgttgtaatgacggtgccatctcat
gttgcaagtggtctcttgcgccctctttctgaatctgctgcaaatgcactctcaaaacta
tattacccaccagttgcagcagtatctatctcgtacccgaaagaagcaatccgaacagaa
tgtttgatagatggtgaactaaagggttttgggcaattgcatccacgcacgcaaggagtt
gaaacattaggaactatctacagctcctcactctttccaaatcgcgcaccgcccggaaga
attttgctgttgaactacattggcgggtctacaaacaccggaattctgtccaagtctgaa
ggtgagttagtggaagcagttgacagagatttgaggaaaatgctaattaagcctaattcg
accgatccacttaaattaggagttagggtatggcctcaagccattcctcagtttctagtt
ggtcactttgatatccttgacacggctaaatcatctctaacgtcttcgggctacgaaggg
ctatttttgggtggcaattacgtcgctggtgtagccttaggccggtgtgtagaaggcgca
tatgaaaccgcgattgaggtcaacaacttcatgtcacggtacgcttacaagtaa

DBGET integrated database retrieval system