KEGG   Arabidopsis thaliana (thale cress): AT4G02020Help
Entry
AT4G02020         CDS       T00041                                 

Gene name
SWN
Definition
histone-lysine N-methyltransferase EZA1
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AT4G02020 (SWN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 856 aa AA seqDB search
MVTDDSNSSGRIKSHVDDDDDGEEEEDRLEGLENRLSELKRKIQGERVRSIKEKFEANRK
KVDAHVSPFSSAASSRATAEDNGNSNMLSSRMRMPLCKLNGFSHGVGDRDYVPTKDVISA
SVKLPIAERIPPYTTWIFLDRNQRMAEDQSVVGRRQIYYEQHGGETLICSDSEEEPEPEE
EKREFSEGEDSIIWLIGQEYGMGEEVQDALCQLLSVDASDILERYNELKLKDKQNTEEFS
NSGFKLGISLEKGLGAALDSFDNLFCRRCLVFDCRLHGCSQPLISASEKQPYWSDYEGDR
KPCSKHCYLQLKAVREVPETCSNFASKAEEKASEEECSKAVSSDVPHAAASGVSLQVEKT
DIGIKNVDSSSGVEQEHGIRGKREVPILKDSNDLPNLSNKKQKTAASDTKMSFVNSVPSL
DQALDSTKGDQGGTTDNKVNRDSEADAKEVGEPIPDNSVHDGGSSICQPHHGSGNGAIII
AEMSETSRPSTEWNPIEKDLYLKGVEIFGRNSCLIARNLLSGLKTCLDVSNYMRENEVSV
FRRSSTPNLLLDDGRTDPGNDNDEVPPRTRLFRRKGKTRKLKYSTKSAGHPSVWKRIAGG
KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP
CFAAGRECDPDVCRNCWVSCGDGSLGEAPRRGEGQCGNMRLLLRQQQRILLGKSDVAGWG
AFLKNSVSKNEYLGEYTGELISHHEADKRGKIYDRANSSFLFDLNDQYVLDAQRKGDKLK
FANHSAKPNCYAKVMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPVWARKPEGSKK
DDSAITHRRARKHQSH
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggacgatagcaactcctctggacgaatcaagtctcatgtagatgatgatgat
gatggtgaagaagaagaagatagactcgagggtttggaaaacagattaagtgagcttaaa
aggaaaattcaaggagaaagagttaggtctattaaagagaaatttgaggctaatagaaag
aaagtggatgctcatgtttctcccttttcatctgctgcatcgagccgagctaccgcagag
gataatggaaatagcaatatgctttcttcgagaatgagaatgccactctgcaagttaaat
ggtttttctcatggtgtgggagatagagactatgttcctactaaggatgttatatcagca
agtgtcaagcttcctattgctgagagaataccgccatacactacctggatatttttggac
agaaatcaaagaatggctgaagatcagtctgtggttggtcgaagacaaatctactatgaa
caacatggtggtgagacgctaatatgcagcgatagtgaggaagaaccagaacctgaggag
gaaaaacgtgaattttccgagggtgaagattccattatatggttaattgggcaggagtat
ggcatgggtgaggaagtgcaggatgccctttgccagttgctaagcgtagatgcttctgat
atcctggaaagatacaatgagctcaagttgaaggataagcagaataccgaggaattttct
aattccggattcaagctgggaatatctctggaaaagggccttggtgcagctctagattct
tttgataatcttttctgccgccgttgcttggtatttgactgtcgtctgcatggatgttct
cagcctttgattagtgctagtgaaaaacagccttattggtctgattatgaaggtgatagg
aaaccctgcagcaaacattgttacctccagctcaaggcggtcagagaagtaccagaaaca
tgcagtaattttgcatctaaagcagaagagaaagcttcagaagaggaatgcagcaaggct
gtctcctctgatgttccccatgctgctgctagtggtgtcagtctgcaagttgagaagact
gatattggtatcaagaatgtagattcatcctctggtgtagaacaagagcatggaattaga
ggaaagcgtgaggtcccaattctaaaagactccaatgatctgcctaatttatcgaacaag
aaacagaagaccgcagcctcagatacaaaaatgtcatttgttaattctgtccctagctta
gatcaggcattggatagcacaaagggtgatcaaggtggaacaactgacaataaagtaaac
agagactcagaagctgatgcaaaagaagtaggtgagcctattccagacaattcggtccat
gatggtggttcctcaatttgtcagccacaccatggtagtggaaacggagcaataatcatt
gcagaaatgtctgagacaagtcgaccatctacagagtggaatcctatcgagaaggatctt
tacttgaagggagtcgaaatctttggaagaaacagctgtcttattgcaagaaacctgctt
tctggcttgaagacatgcctagatgtgtccaattacatgcgtgaaaacgaagtttcagtt
tttcgaagatctagtaccccaaatttgctgttggatgatggcaggactgacccagggaat
gataatgatgaggtgcctccaaggacaagattgttccgtagaaaaggcaaaacccggaag
ctaaaatactctacaaagtctgctggtcatccgtctgtctggaaaagaatagctggtggc
aaaaaccagtcctgtaaacaatacacgccgtgtggatgcctgtcaatgtgcggaaaggat
tgcccttgtctaactaatgaaacttgctgcgagaaatattgcgggtgctcaaaaagctgt
aaaaatcgtttccgaggatgtcattgtgcaaagagtcaatgcagaagtaggcagtgtccc
tgctttgctgctggcagagaatgtgatccagatgtttgcagaaattgctgggttagttgt
ggagatggttctctcggtgaagcaccaagacgcggagaagggcaatgcggaaacatgaga
cttctcctgaggcaacaacagaggatcctattgggaaagtctgatgttgctggatggggt
gcttttctaaagaactcggtcagcaaaaatgaataccttggagaatacaccggtgaattg
atctcacaccatgaggcggataagcgtgggaaaatatatgaccgggcaaattcgtccttc
ctctttgacttgaatgatcagtacgtcctcgatgctcaacgcaaaggtgacaagctgaaa
tttgccaatcactcagctaaacccaattgctacgctaaggtgatgtttgtagcaggagat
cacagggtcgggatttttgcaaacgaacgaatagaagctagcgaagagcttttctatgac
tatagatatggaccagaccaagcaccagtgtgggctcgcaaacctgaaggctccaagaaa
gatgattcagccattactcatcgtagagccagaaagcaccaatctcattga

DBGET integrated database retrieval system