KEGG   Arabidopsis thaliana (thale cress): AT4G02610Help
Entry
AT4G02610         CDS       T00041                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT4G02610
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G02610
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT4G02610
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AT4G02610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 275 aa AA seqDB search
MDLLKTPSSTVGLSETFARLKSQGKVALIPYITAGDPDLSTTAKALKVLDSCGSDIIELG
VPYSDPLADGPAIQAAARRSLLKGTNFNSIISMLKEVIPQLSCPIALFTYYNPILRRGVE
NYMTVIKNAGVHGLLVPDVPLEETETLRNEARKHQIELVLLTTPTTPKERMNAIVEASEG
FIYLVSSVGVTGTRESVNEKVQSLLQQIKEATSKPVAVGFGISKPEHVKQVAEWGADGVI
VGSAMVKILGESESPEQGLKELEFFTKSLKSALVS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggatcttctcaagactccttcctccacggttggtctatcagaaacattcgctaggtta
aagtcacaaggcaaagtggctctgattccatatatcacagctggtgatcctgatctttct
acaacagcgaaagctcttaaagtgcttgattcgtgtggctccgacataatcgaactcggt
gttccatactctgatccattagctgatggtccagcaatccaggctgctgcgagacgttcg
ttacttaaaggaaccaactttaactccattatctctatgcttaaagaggttattcctcag
ttatcttgtccaattgcattgtttacatattacaatccaatcctgcgacgaggagtagag
aactacatgactgttataaagaatgctggagttcatgggcttctggttcctgatgttcca
ctcgaggagactgaaactctgcggaacgaagctcggaagcatcaaattgagctagtactg
ctcacaacacccacaactccaaaagaacgaatgaatgccattgttgaagcctctgaagga
tttatctatctcgtaagttcagtaggggttactggtacaagagagtctgttaacgaaaaa
gttcaatctcttctacaacaaatcaaagaggcaactagcaagccagtggcagttggattt
ggcatatcaaaacctgagcatgtgaaacaggtagctgaatggggagcagacggagtcatt
gttggtagcgcgatggttaagatcttgggcgagtctgaatcacctgagcaaggacttaag
gagctagaattcttcactaaatctttgaagtctgctcttgtctcttga

DBGET integrated database retrieval system