KEGG   Arabidopsis thaliana (thale cress): AT4G04320Help
Entry
AT4G04320         CDS       T00041                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AT4G04320
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G04320
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AT4G04320
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     AT4G04320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 518 aa AA seqDB search
MSKKNLAILLRARMRSNNPSKFSLSQFPKEIQSNPQENHSRDHIVQNSNDFGTTGRVYDV
VRETMHSAISASKTGVLDITLNDFQEGYFSLSLEDREKLLLVLAKEYDVNREQVRELVKQ
YLGLETPASDDDKGALSSVFYRIERNLRHALRPTYEVLFERLNTHPGGLRFLSILRADLL
SILSKENTPSLRTLDSFLKEKLGMWLSPATLELHQITWDDPASLLEKIVAYEAVHPISNL
LDLKRRLGIGRRCFGYFHPSVPGEPLIFIEVALMETVAQTIQEVLWDNPPIPENQATCAL
FYSISSTQPGLAGINLGKFLIKRVITLVKKDMPHVSTFATLSPIPGFMQWLLSKLSSQSR
FAEDERGTQSNSPSSTFSEKVLLPEEEHALMTLSDESSSGSNGMEVLLNLLSVKNCDWAT
SPRLLPVLEPILMRLCARYLLQEKKRGKALDSVANFHLQNGAMVERINWMADRSEKGIRQ
SGGIMVNYVYRLENIEDYAQSYFGSGKIHASPGIHSRL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaaatctagcgattctgttgcgtgctagaatgagatccaacaatccctcc
aaattttccctctctcaatttcctaaggaaattcaatctaatcctcaagagaatcattct
agagatcacattgtgcaaaattctaatgattttggtaccactggaagggtttatgatgtt
gttcgagagacaatgcactcagctatctcagctagtaaaactggtgtattagacattact
cttaatgattttcaagagggttactttagcctttcgcttgaagaccgcgagaagttactg
cttgttttagccaaggagtatgatgttaaccgagagcaagtccgagaacttgttaagcaa
tatcttggacttgaaactccagctagtgatgatgataagggggctttatcttctgttttc
tatcgcattgagaggaatctgaggcatgctcttaggccaacatatgaagttttatttgag
aggttgaatacacatcctggagggttgagatttttgtccatcctccgagctgatcttctg
tcgatactctcaaaagagaacacgccgtctttgcgaacattagattcttttctgaaggag
aaactcggtatgtggcttagtcctgccactttagagcttcatcaaattacttgggatgat
cctgcttcattgcttgagaaaattgttgcatatgaggcggtgcatccaatcagcaacctc
ttggatcttaaaagaagattgggaataggccgtcgatgctttggatattttcatccatct
gttcctggtgagccacttatttttatagaagttgctcttatggagactgttgctcagaca
attcaggaagttttgtgggacaatcctcccataccagagaaccaagcaacatgcgcttta
ttttactctatttcttcaactcagcctggcttagctgggataaacctcggaaaatttctg
atcaaacgagtgattacgttggtgaaaaaagacatgccacatgtttctacatttgcaaca
cttagccccattcctggattcatgcaatggctcctctcgaagttatcatctcagtcaaga
tttgctgaagatgagcgtggtacacagagcaattcgccttcatctacgtttagtgagaaa
gtattactaccagaagaggaacatgccctcatgactctatcagatgaatcttcatccggt
agcaacggtatggaagttctgttgaatttgctatcagtaaagaactgcgattgggctact
tcgcctcgcctattaccagttttagaacctattcttatgcggttatgtgctaggtacctc
ttgcaagagaagaagagaggaaaagctttagactctgttgctaacttccacttgcaaaat
ggagcgatggttgaaagaataaattggatggcggatcgatcagagaaaggtattcgtcaa
agtggaggcattatggtaaactatgtctataggttagagaatatcgaagactatgctcaa
tcgtattttgggtcgggcaaaatccatgcctctcccggtatccattcccgtctctag

DBGET integrated database retrieval system