KEGG   Arabidopsis thaliana (thale cress): AT4G04750Help
Entry
AT4G04750         CDS       T00041                                 

Definition
(RefSeq) sugar transporter ERD6-like 14
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 482 aa AA seqDB search
MAEESLLPSHTEDVSASPNKSSSLLSEISNASTRPFVLAFTVGSCGALSFGCIVGYTAPT
QSSIMKDLNLSIADFSFFGSILTVGLILGALICGKLADLVGRVYTIWITNILVLIGWLAI
AFAKDVRLLDLGRLLQGISVGISSYLGPIYISELAPRNLRGAASSLMQLFVGVGLSAFYA
LGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWLAKVGREKEVEGVLLSLRGAKSDVSD
EAATILEYTKHVEQQDIDSRGFFKLFQRKYALPLTIGVVLISMPQLGGLNGYTFYTDTIF
TSTGVSSDIGFILTSIVQMTGGVLGVLLVDISGRRSLLLFSQAGMFLGCLATAISFFLQK
NNCWETGTPIMALISVMVYFGSYGLGMGPIPWIIASEIYPVDVKGAAGTVCNLVTSISSW
LVTYSFNFLLQWSSTGTFMMFATVMGLGFVFTAKLVPETKGKSLEEIQSAFTDSTSEDST
IF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaatctttattaccatctcatacagaagatgtatcagcttctcctaataaa
tcttcatcacttctgtctgaaatatcaaatgcttccacgagaccttttgttcttgctttc
actgttggttcttgtggtgccttgagctttggatgcattgttggatatacagctcctaca
cagtccagtatcatgaaagacttgaatctatccatagctgatttttcattttttggatcg
atattgacagtggggctaatccttggagcattaatttgtgggaaattggcagatttggtt
ggtcgtgtctatacgatatggattacaaacattcttgttttaatcggctggttagctatt
gcatttgccaaggatgttcggctactcgatcttggaaggttattgcaagggatctcggtc
ggaattagctcatatttgggacctatttacattagcgagttagcaccaagaaatttgcga
ggagctgcttcttcgttgatgcagttatttgtcggtgtgggtctatcggccttttatgct
ctcggaacagccgttgcttggcgcagtttagccattttaggatctataccttctctagtg
gttctgcctcttcttttcttcatccccgaatctcctagatggctagctaaagttgggagg
gaaaaggaggttgaaggggttttattaagcttgcgaggagcaaaatctgatgtatcagat
gaagcagcaacgatattagaatatacaaaacatgtcgaacaacaagacatcgatagccgc
ggtttcttcaagttgttccagcgaaaatacgcgttgccactaactattggagttgtcctt
atatctatgcctcagcttggaggtcttaatggttatactttttacaccgataccattttc
acctctaccggtgtatcaagtgacattggattcatattgacatctattgttcagatgact
ggaggcgttttaggtgttttgcttgtggatatatccggaagacgttctctcctactgttt
tctcaagctggaatgttcttgggttgtctagcaacagccatttcattcttcttgcagaag
aacaattgctgggaaacaggaacaccaataatggctctcattagtgttatggtgtatttt
ggatcatacggattaggcatgggaccaataccatggatcatagcatcagagatttaccct
gtagacgtgaaaggagcagcaggaacagtgtgtaacttggtcacctctataagctcatgg
ctcgttacttactccttcaattttttgcttcaatggagttctacaggaacgtttatgatg
tttgccactgtgatgggtcttggatttgtgttcacagccaagcttgttccagagaccaaa
ggcaaatctttagaagaaattcaatctgcttttactgattctacttctgaagattctaca
attttctaa

DBGET integrated database retrieval system