KEGG   Arabidopsis thaliana (thale cress): AT4G05090Help
Entry
AT4G05090         CDS       T00041                                 

Definition
Inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ath00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 397 aa AA seqDB search
MYILDTGARFSAVRFSPVFNPPPTSLRRRYFIVRANLPFPKHQAKYHKELEVAIDAVDRA
CRLCVDVKRSLFSSKEKIVEKNDQTPVTIADFGVQALVSLELSKLFPSIPLVAEEDSHFV
RANNLVSSVVSEVKSKASIGDNHLSDADVLEAIDRGGKDAYTFCNKPATYWVLDPIDGTR
GFLKGDEALYVVGLALVVDNEIVLGVMGCPNWPGDSSDGSTGTLMLSHIGCGTWTKKLQN
VSGNVAGDWIRCFVDACVLMNKARFCIQESQTWESLPLSGFFDASTVSEDLKHKEILLLP
TCCGSLCKYLMVASGRASVFLLRAKTQRTIKSWDHAVGIICVHEAGGKVTDWEGDEINLE
EDQSERRLIFPAGGVVVSNGSLHNQILEMISSASPTL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacattctcgacaccggagctcgattctccgccgtcagattctcaccggtattcaat
cctcctccaacatctctccgtagacgatacttcatcgtaagagctaatcttccattccca
aagcatcaagctaagtatcataaagagcttgaggtcgccattgatgctgttgatcgagct
tgtcgtctctgtgttgatgtcaaaagatctcttttttcttctaaagagaagattgttgag
aagaatgatcaaactccagttacaattgcagattttggagttcaagctttagtcagcttg
gagctttcgaaattgtttccttcaataccattagtggctgaggaagactctcattttgtg
cgtgctaataaccttgtaagctctgtggtaagtgaagtcaaatcaaaagcaagcattgga
gacaatcacttgtctgatgctgatgtacttgaagcaattgatagaggtggcaaagatgct
tacacgttttgcaacaaaccagctacttattgggttttggatccaattgatggcaccagg
ggatttcttaaaggagatgaggctttatatgtggtaggattggcccttgttgtagataat
gaaattgtgctaggagtcatgggttgtccaaactggccaggagattcttcagatggatct
actggaaccctaatgctctcgcatataggctgtggaacgtggaccaagaagttacaaaat
gtctctggcaatgtagccggtgattggataaggtgtttcgttgatgcttgtgttttaatg
aacaaagcaagattttgtatacaagaaagccaaacctgggaatcacttcctctctctggt
ttcttcgacgcaagtactgtttcagaggacttaaaacataaagagattcttcttttgccc
acatgttgtggaagtttgtgcaagtatctgatggtagcttctggcagagcatcagttttt
cttctccgagccaaaactcagagaacaataaagtcgtgggatcatgctgttgggatcata
tgtgtacatgaagctggaggaaaggtaacagattgggaaggagatgaaataaatttggag
gaagatcaatcagaaaggaggctcatttttccggcgggcggtgttgtagtaagcaacgga
agtttacataatcagattcttgagatgatctcttctgcttcaccaactctttga

DBGET integrated database retrieval system