KEGG   Arabidopsis thaliana (thale cress): AT4G05090Help
Entry
AT4G05090         CDS       T00041                                 

Definition
Inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AT4G05090
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AT4G05090
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AT4G05090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 397 aa AA seqDB search
MYILDTGARFSAVRFSPVFNPPPTSLRRRYFIVRANLPFPKHQAKYHKELEVAIDAVDRA
CRLCVDVKRSLFSSKEKIVEKNDQTPVTIADFGVQALVSLELSKLFPSIPLVAEEDSHFV
RANNLVSSVVSEVKSKASIGDNHLSDADVLEAIDRGGKDAYTFCNKPATYWVLDPIDGTR
GFLKGDEALYVVGLALVVDNEIVLGVMGCPNWPGDSSDGSTGTLMLSHIGCGTWTKKLQN
VSGNVAGDWIRCFVDACVLMNKARFCIQESQTWESLPLSGFFDASTVSEDLKHKEILLLP
TCCGSLCKYLMVASGRASVFLLRAKTQRTIKSWDHAVGIICVHEAGGKVTDWEGDEINLE
EDQSERRLIFPAGGVVVSNGSLHNQILEMISSASPTL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacattctcgacaccggagctcgattctccgccgtcagattctcaccggtattcaat
cctcctccaacatctctccgtagacgatacttcatcgtaagagctaatcttccattccca
aagcatcaagctaagtatcataaagagcttgaggtcgccattgatgctgttgatcgagct
tgtcgtctctgtgttgatgtcaaaagatctcttttttcttctaaagagaagattgttgag
aagaatgatcaaactccagttacaattgcagattttggagttcaagctttagtcagcttg
gagctttcgaaattgtttccttcaataccattagtggctgaggaagactctcattttgtg
cgtgctaataaccttgtaagctctgtggtaagtgaagtcaaatcaaaagcaagcattgga
gacaatcacttgtctgatgctgatgtacttgaagcaattgatagaggtggcaaagatgct
tacacgttttgcaacaaaccagctacttattgggttttggatccaattgatggcaccagg
ggatttcttaaaggagatgaggctttatatgtggtaggattggcccttgttgtagataat
gaaattgtgctaggagtcatgggttgtccaaactggccaggagattcttcagatggatct
actggaaccctaatgctctcgcatataggctgtggaacgtggaccaagaagttacaaaat
gtctctggcaatgtagccggtgattggataaggtgtttcgttgatgcttgtgttttaatg
aacaaagcaagattttgtatacaagaaagccaaacctgggaatcacttcctctctctggt
ttcttcgacgcaagtactgtttcagaggacttaaaacataaagagattcttcttttgccc
acatgttgtggaagtttgtgcaagtatctgatggtagcttctggcagagcatcagttttt
cttctccgagccaaaactcagagaacaataaagtcgtgggatcatgctgttgggatcata
tgtgtacatgaagctggaggaaaggtaacagattgggaaggagatgaaataaatttggag
gaagatcaatcagaaaggaggctcatttttccggcgggcggtgttgtagtaagcaacgga
agtttacataatcagattcttgagatgatctcttctgcttcaccaactctttga

DBGET integrated database retrieval system