KEGG   Arabidopsis thaliana (thale cress): AT4G05320Help
Entry
AT4G05320         CDS       T00041                                 

Gene name
UBQ10
Definition
(RefSeq) polyubiquitin 10
  KO
K08770  
ubiquitin C
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Ubiquitin system [BR:ath04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   AT4G05320 (UBQ10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 457 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgttaagactctcaccggaaagacaatcaccctcgaggtggaaagctcc
gacaccatcgacaacgttaaggccaagatccaggataaggagggcattcctccggatcag
cagaggcttattttcgccggcaagcagctagaggatggccgtacgttggctgattacaat
atccagaaggaatccaccctccacttggtcctcaggctccgtggtggtatgcagattttc
gttaaaaccctaacgggaaagacgattactcttgaggtggagagttctgacaccatcgac
aacgtcaaggccaagatccaagacaaagagggtattcctccggaccagcagaggctgatc
ttcgccggaaagcagttggaggatggcagaactcttgctgactacaatatccagaaggag
tccacccttcatcttgttctcaggctccgtggtggtatgcagattttcgttaagacgttg
actgggaaaactatcactttggaggtggagagttctgacaccattgataacgtgaaagcc
aagatccaagacaaagagggtattcctccggaccagcagagattgatcttcgccggaaaa
caacttgaagatggcagaactttggccgactacaacattcagaaggagtccacactccac
ttggtcttgcgtctgcgtggaggtatgcagatcttcgtgaagactctcaccggaaagacc
atcactttggaggtggagagttctgacaccattgataacgtgaaagccaagatccaggac
aaagagggtatcccaccggaccagcagagattgatcttcgccggaaagcaacttgaagat
ggaagaactttggctgactacaacattcagaaggagtccacacttcacttggtcttgcgt
ctgcgtggaggtatgcagatcttcgtgaagactctcaccggaaagactatcactttggag
gtagagagctctgacaccattgacaacgtgaaggccaagatccaggataaggaaggaatc
cctccggaccagcagaggttgatctttgccggaaaacaattggaggatggtcgtactttg
gcggattacaacatccagaaggagtcgacccttcacttggtgttgcgtctgcgtggaggt
atgcagatcttcgtcaagactttgaccggaaagaccatcacccttgaagtggaaagctcc
gacaccattgacaacgtcaaggccaagatccaggacaaggaaggtattcctccggaccag
cagcgtctcatcttcgctggaaagcagcttgaggatggacgtactttggccgactacaac
atccagaaggagtctactcttcacttggtcctgcgtcttcgtggtggtttctaa

DBGET integrated database retrieval system