KEGG   Arabidopsis thaliana (thale cress): AT4G05320Help
Entry
AT4G05320         CDS       T00041                                 

Gene name
UBQ10
Definition
polyubiquitin 10
Orthology
K08770  
ubiquitin C
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 381 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgttaagactctcaccggaaagacaatcaccctcgaggtggaaagctcc
gacaccatcgacaacgttaaggccaagatccaggataaggagggcattcctccggatcag
cagaggcttattttcgccggcaagcagctagaggatggccgtacgttggctgattacaat
atccagaaggaatccaccctccacttggtcctcaggctccgtggtggtatgcagattttc
gttaagacgttgactgggaaaactatcactttggaggtggagagttctgacaccattgat
aacgtgaaagccaagatccaagacaaagagggtattcctccggaccagcagagattgatc
ttcgccggaaaacaacttgaagatggcagaactttggccgactacaacattcagaaggag
tccacactccacttggtcttgcgtctgcgtggaggtatgcagatcttcgtgaagactctc
accggaaagaccatcactttggaggtggagagttctgacaccattgataacgtgaaagcc
aagatccaggacaaagagggtatcccaccggaccagcagagattgatcttcgccggaaag
caacttgaagatggaagaactttggctgactacaacattcagaaggagtccacacttcac
ttggtcttgcgtctgcgtggaggtatgcagatcttcgtgaagactctcaccggaaagact
atcactttggaggtagagagctctgacaccattgacaacgtgaaggccaagatccaggat
aaggaaggaatccctccggaccagcagaggttgatctttgccggaaaacaattggaggat
ggtcgtactttggcggattacaacatccagaaggagtcgacccttcacttggtgttgcgt
ctgcgtggaggtatgcagatcttcgtcaagactttgaccggaaagaccatcacccttgaa
gtggaaagctccgacaccattgacaacgtcaaggccaagatccaggacaaggaaggtatt
cctccggaccagcagcgtctcatcttcgctggaaagcagcttgaggatggacgtactttg
gccgactacaacatccagaaggagtctactcttcacttggtcctgcgtcttcgtggtggt
ttctaa

DBGET integrated database retrieval system