KEGG   Arabidopsis thaliana (thale cress): AT4G08210Help
Entry
AT4G08210         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR-like) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 PPR_3 PPR_long TPR_7 TPR_17
Motif
Other DBs
NCBI-GeneID: 826371
NCBI-ProteinID: NP_192561
MIPS: AT4G08210.1
TAIR: AT4G08210
Araport: AT4G08210
UniProt: Q9SUF9
Position
4
AA seq 686 aa AA seqDB search
MVMDLKLIAAGLRHCGKVQAFKRGESIQAHVIKQGISQNVFIANNVISMYVDFRLLSDAH
KVFDEMSERNIVTWTTMVSGYTSDGKPNKAIELYRRMLDSEEEAANEFMYSAVLKACGLV
GDIQLGILVYERIGKENLRGDVVLMNSVVDMYVKNGRLIEANSSFKEILRPSSTSWNTLI
SGYCKAGLMDEAVTLFHRMPQPNVVSWNCLISGFVDKGSPRALEFLVRMQREGLVLDGFA
LPCGLKACSFGGLLTMGKQLHCCVVKSGLESSPFAISALIDMYSNCGSLIYAADVFHQEK
LAVNSSVAVWNSMLSGFLINEENEAALWLLLQIYQSDLCFDSYTLSGALKICINYVNLRL
GLQVHSLVVVSGYELDYIVGSILVDLHANVGNIQDAHKLFHRLPNKDIIAFSGLIRGCVK
SGFNSLAFYLFRELIKLGLDADQFIVSNILKVCSSLASLGWGKQIHGLCIKKGYESEPVT
ATALVDMYVKCGEIDNGVVLFDGMLERDVVSWTGIIVGFGQNGRVEEAFRYFHKMINIGI
EPNKVTFLGLLSACRHSGLLEEARSTLETMKSEYGLEPYLEHYYCVVDLLGQAGLFQEAN
ELINKMPLEPDKTIWTSLLTACGTHKNAGLVTVIAEKLLKGFPDDPSVYTSLSNAYATLG
MWDQLSKVREAAKKLGAKESGMSWII
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggttatggacttgaagcttatagcagcaggattacgtcattgtgggaaagtacaagcc
tttaagcgtggagaatcaattcaagctcatgtaatcaagcaagggatctctcaaaatgtg
tttatagcgaataacgtgatctcaatgtatgtggatttcaggttgttgagtgatgcacat
aaagtgttcgatgaaatgtctgagagaaatattgtaacttggacaacgatggtttctggg
tatacgagtgatggaaaacccaataaagctattgagttatacagaagaatgttagactcc
gaagaagaagcggcgaacgagtttatgtattctgcggttttgaaagcttgtgggttagtg
ggtgatattcagctggggattttggtttatgaaagaattggtaaagagaatttgagaggt
gatgttgttttgatgaatagtgttgttgatatgtatgttaagaatgggagacttatcgaa
gctaatagcagttttaaggagattttacggcctagttcgacttcgtggaacactcttatt
tctggttattgtaaagctggtttgatggatgaagcggttactttgttccatcgaatgccg
cagccaaatgtcgtgtcttggaactgtttgatatcgggatttgtcgataagggtagtcct
cgtgcgttggagtttttagttaggatgcagagagaaggacttgtgttagacggttttgct
ttaccatgtggtcttaaagcttgtagttttggtggcttattaacaatgggtaaacagctg
cattgttgtgtcgtaaagtcgggtctagagtctagcccgttcgcaatatctgctcttatt
gatatgtactcgaactgtggctctctaatatatgcagctgatgtttttcatcaggaaaaa
ctggccgttaatagtagtgtcgcggtttggaattctatgctctctggatttttgataaat
gaggagaatgaagcagcattatggctgcttttgcagatatatcagtcagatttgtgtttt
gattcctacactctaagtggtgccttaaagatatgtatcaactatgtcaacttaagactc
gggcttcaagtacatagtttagttgtagtaagtggttatgagttggattacatcgtagga
agtattcttgttgatttacatgcaaatgttgggaatatacaagatgcacataaactgttt
cataggcttccaaataaagatatcatcgctttctctggcttgatacgaggctgtgtgaaa
tcagggttcaattctttagcattttatctgttcagggaattaatcaagttgggactcgat
gctgaccagttcatcgtctcaaatattcttaaagtttgttcaagtttagcatctcttgga
tggggtaagcaaattcatgggttgtgtataaagaaaggttatgaatcagaacctgtcaca
gcgacagcactagtagatatgtatgtaaaatgtggtgagatagataatggtgtagtgttg
tttgatggtatgttagaaagagatgttgtctcttggacagggataattgttggattcgga
caaaacggacgagtcgaagaagcgtttcggtatttccacaagatgataaatattggaatt
gaaccaaataaggtaacttttttggggcttctttctgcttgccgacattctggactactt
gaagaagcaagatcaaccctcgaaacgatgaaatctgaatatggtcttgaaccgtatcta
gagcattattattgtgtagttgatcttcttggtcaagccgggctgttccaagaggctaac
gaattgataaataaaatgccgttggagcccgacaaaacaatatggacgtctctgctcact
gcttgcggaactcacaagaatgccggactggttactgtaattgctgagaaattactcaag
gggtttccggatgatccatcggtttatacatctctttcgaatgcttatgctacgttaggc
atgtgggatcagttaagtaaagtgagagaagctgctaagaagctaggggcaaaagaatct
ggaatgagttggataatttag

DBGET integrated database retrieval system