KEGG   Arabidopsis thaliana (thale cress): AT4G08770Help
Entry
AT4G08770         CDS       T00041                                 

Definition
(RefSeq) peroxidase 37
  KO
K00430  
peroxidase [EC:1.11.1.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT4G08770
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     AT4G08770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 346 aa AA seqDB search
MHSSLIKLGFLLLLIQVSLSHAQLSPSFYDKTCPQVFDIATTTIVNALRSDPRIAASILR
LHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFDVIDKMKAAVEKACPKTVSCA
DLLAIAAQESVVLAGGPSWRVPNGRRDSLRGFMDLANDNLPAPFFTLNQLKDRFKNVGLD
RASDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLDKSYLSTLRKQCPRNGNQSVL
VDFDLRTPTLFDNKYYVNLKENKGLIQSDQELFSSPDASDTLPLVREYADGQGKFFDAFA
KAMIRMSSLSPLTGKQGEIRLNCRVVNSKSKIMDVVEDALEFASSM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcattcctctttgataaaattgggatttcttcttcttcttattcaggtatcattgtct
catgctcaactaagcccttccttttacgataaaacatgtccgcaagtctttgacattgca
accactaccattgtcaatgctctaagatcggaccctcgcatcgctgcaagcatccttcgt
cttcatttccacgactgctttgttaatggatgtgatgcatcgatattgttagacaacacc
acatcgtttaggacggagaaagatgcgtttgggaacgctaattccgctcgaggtttcgat
gtgatcgacaaaatgaaggctgccgtggagaaagcatgtcctaaaactgtttcatgtgct
gatttgctcgccatcgcggctcaagaatctgtcgttttggcgggaggtccttcatggagg
gttccaaatggaagaagagacagcttaagagggttcatggatcttgctaatgataacctt
ccagctccattctttacccttaaccaacttaaggatagattcaaaaacgtcggactcgac
cgtgcttctgatctcgttgctctttctggtggtcacacctttggcaaaaaccaatgtcaa
ttcataatggatcggctttataacttcagtaacactggtttacccgacccaacccttgat
aaatcttacctctccacactcagaaaacaatgtccacgtaatggaaaccagagtgtattg
gtagattttgatttacgtacgccaacactctttgacaacaagtattatgtgaacctcaag
gagaacaaaggacttatccagagcgaccaagagttattctctagccctgatgcttcagac
actcttcctttagtccgagaatacgctgatggtcaagggaaatttttcgatgcgttcgcg
aaggcaatgataaggatgagtagtctttcacctttaacagggaaacaaggagaaataaga
ttgaactgtagagtggtgaattcgaaatctaaaatcatggatgtggtagaagatgctctt
gaatttgcaagctcaatgtga

DBGET integrated database retrieval system