KEGG   Arabidopsis thaliana (thale cress): AT4G08770Help
Entry
AT4G08770         CDS       T00041                                 

Gene name
Prx37
Definition
(RefSeq) Peroxidase superfamily protein
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT4G08770 (Prx37)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     AT4G08770 (Prx37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: peroxidase
Motif
Other DBs
NCBI-GeneID: 826447
NCBI-ProteinID: NP_192617
MIPS: AT4G08770.1
TAIR: AT4G08770
Araport: AT4G08770
UniProt: Q9LDN9
Position
4
AA seq 346 aa AA seqDB search
MHSSLIKLGFLLLLIQVSLSHAQLSPSFYDKTCPQVFDIATTTIVNALRSDPRIAASILR
LHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFDVIDKMKAAVEKACPKTVSCA
DLLAIAAQESVVLAGGPSWRVPNGRRDSLRGFMDLANDNLPAPFFTLNQLKDRFKNVGLD
RASDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLDKSYLSTLRKQCPRNGNQSVL
VDFDLRTPTLFDNKYYVNLKENKGLIQSDQELFSSPDASDTLPLVREYADGQGKFFDAFA
KAMIRMSSLSPLTGKQGEIRLNCRVVNSKSKIMDVVEDALEFASSM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcattcctctttgataaaattgggatttcttcttcttcttattcaggtatcattgtct
catgctcaactaagcccttccttttacgataaaacatgtccgcaagtctttgacattgca
accactaccattgtcaatgctctaagatcggaccctcgcatcgctgcaagcatccttcgt
cttcatttccacgactgctttgttaatggatgtgatgcatcgatattgttagacaacacc
acatcgtttaggacggagaaagatgcgtttgggaacgctaattccgctcgaggtttcgat
gtgatcgacaaaatgaaggctgccgtggagaaagcatgtcctaaaactgtttcatgtgct
gatttgctcgccatcgcggctcaagaatctgtcgttttggcgggaggtccttcatggagg
gttccaaatggaagaagagacagcttaagagggttcatggatcttgctaatgataacctt
ccagctccattctttacccttaaccaacttaaggatagattcaaaaacgtcggactcgac
cgtgcttctgatctcgttgctctttctggtggtcacacctttggcaaaaaccaatgtcaa
ttcataatggatcggctttataacttcagtaacactggtttacccgacccaacccttgat
aaatcttacctctccacactcagaaaacaatgtccacgtaatggaaaccagagtgtattg
gtagattttgatttacgtacgccaacactctttgacaacaagtattatgtgaacctcaag
gagaacaaaggacttatccagagcgaccaagagttattctctagccctgatgcttcagac
actcttcctttagtccgagaatacgctgatggtcaagggaaatttttcgatgcgttcgcg
aaggcaatgataaggatgagtagtctttcacctttaacagggaaacaaggagaaataaga
ttgaactgtagagtggtgaattcgaaatctaaaatcatggatgtggtagaagatgctctt
gaatttgcaagctcaatgtga

DBGET integrated database retrieval system