KEGG   Arabidopsis thaliana (thale cress): AT4G08870Help
Entry
AT4G08870         CDS       T00041                                 

Definition
arginine amidohydrolase 2
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT4G08870
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AT4G08870
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AT4G08870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 263 aa AA seqDB search
MWKIGQRGVPYFQRLIAAPFTTLRSLPTSLVETGQNRVIDASLTLIRERAKLKGELVRLI
GGAKATTALLGVPLGHNSSFLEGPALAPPHVREAIWCGSTNSTTEEGKELKDPRVLSDVG
DIPVQEIREMGVDDDRLMKVVSESVKLVMEEEPLRPLVIGGDHSISYPVVRAVSEKLGGP
VDILHLDAHPDIYDRFEGNYYSHASSFARIMEGGYARRLLQVGIRSINKEGREQGKRFGV
EQYEMRTFSKDRQMLENLVCINF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagattgggcagagaggagttccctatttccagagactcattgctgcgccgttc
acgaccttgcggtccttgccaacttctttggtcgagacagggcagaaccgtgtcattgat
gcttcgttaactctcatccgtgaaagggcaaaactcaaaggagagttagtgcgactcata
ggaggagcaaaagctacaacagctcttcttggagtaccacttggtcacaactcttctttt
cttgaaggcccagccttggctcctcctcatgtaagggaagctatttggtgtggtagtaca
aactccaccactgaagaagggaaggagctaaaagatccacgtgttctaagtgatgttggt
gatattccggtacaagagattagagaaatgggggttgatgatgatagacttatgaaagta
gtaagtgaatctgtgaagctggtgatggaagaggaaccattgcgcccgctggtcataggt
ggagaccattccatatcttatcctgttgtgagagctgtttcggagaaacttggaggaccc
gtggatattcttcatcttgatgcacatcccgatatatatgaccgttttgaaggcaattat
tactctcatgcatcttcttttgctcgtatcatggaaggtggctatgcgcggcggctttta
caggttgggatcagatccataaacaaagaaggacgggaacaaggcaagaggtttggagta
gaacagtatgagatgcgaaccttctcaaaagatcgccaaatgttggaaaacttggtatgt
atcaatttctaa

DBGET integrated database retrieval system