KEGG   Arabidopsis thaliana (thale cress): AT4G08900Help
Entry
AT4G08900         CDS       T00041                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ath00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 342 aa AA seqDB search
MSRIIGRKGINYIHRLNSASFTSVSASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGG
AKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDV
PVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVD
ILHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQ
YEMRTFSKDRPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILH
NLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKISK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggattattggtagaaaagggattaactatatccatagactaaattctgcgtcg
ttcacgagcgtatctgcttcttcaatcgagaaagggcaaaatcgcgtgattgatgcttcg
ttaactcttattcgtgaaagggcaaaactcaaaggagagttagtgcgtcttttaggtgga
gctaaagcttcaacatctcttcttggtgtaccacttggtcacaactcttcttttcttcaa
ggtcctgcttttgctcctcctcgtattcgagaagctatttggtgtggtagcacaaactct
gccactgaagaagggaaggagttgaaggatccacgggttctaactgatgttggggatgtt
ccggtacaagagattagagattgtggggttgatgatgatagactgatgaatgtcataagt
gaatctgtgaagttggtgatggaagaggaaccattgcgtccgttggtcttaggtggagac
cattccatatcttatcctgttgtgagagcggtttctgagaagcttggagggcctgtggac
attcttcatcttgatgcacatccggatatatatgactgttttgaaggaaataagtactct
catgcatcttcttttgctcgtatcatggaaggtggctatgcgcgtaggcttttacaggtt
gggatcagatcgataaaccaggaaggacgggaacaaggcaagaggtttggagtagaacag
tatgagatgcgaaccttctcgaaagatcgcccaatgttggaaaatctgaaattaggggaa
ggagtgaagggggtatacatctcgatagacgttgactgtctcgatccggcatttgcacct
ggagtgtcgcatatcgaaccaggaggtctctctttccgtgacgtccttaacatcttacac
aaccttcaggcagatgttgtcggggctgacgttgtcgagttcaacccgcagcgtgatact
gttgacggcatgacagcaatggttgcagctaagcttgttagagaattagctgcgaaaatc
tcgaaatga

DBGET integrated database retrieval system